Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5DDW3

Protein Details
Accession A0A5N5DDW3    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
88-111GPENDRPARKQKRKGGKPVKPGFIBasic
NLS Segment(s)
PositionSequence
93-108RPARKQKRKGGKPVKP
Subcellular Location(s) nucl 13.5, cyto_nucl 10.5, mito 9, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001579  Glyco_hydro_18_chit_AS  
Gene Ontology GO:0004553  F:hydrolase activity, hydrolyzing O-glycosyl compounds  
GO:0005975  P:carbohydrate metabolic process  
PROSITE View protein in PROSITE  
PS01095  GH18_1  
Amino Acid Sequences MATRRTSGRARPAKRYTNDAFDGLDFDDEATGSEIFAHEEDSGEDDDFDAAAAEDEPDVEEDVSEGAASGEEEDGYGEDMLSDDDIIGPENDRPARKQKRKGGKPVKPGFIQRAEASSFKTGSFSLLASRAHDHKESEIKVSSRGVPEMYHNTDGMMSLCYQADE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.74
3 0.68
4 0.66
5 0.62
6 0.53
7 0.45
8 0.36
9 0.34
10 0.26
11 0.21
12 0.13
13 0.1
14 0.09
15 0.07
16 0.08
17 0.08
18 0.07
19 0.06
20 0.07
21 0.07
22 0.07
23 0.07
24 0.08
25 0.06
26 0.07
27 0.07
28 0.09
29 0.1
30 0.09
31 0.09
32 0.08
33 0.08
34 0.07
35 0.07
36 0.05
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.04
44 0.05
45 0.05
46 0.05
47 0.04
48 0.04
49 0.04
50 0.04
51 0.04
52 0.03
53 0.03
54 0.03
55 0.03
56 0.03
57 0.03
58 0.03
59 0.03
60 0.03
61 0.03
62 0.04
63 0.04
64 0.03
65 0.03
66 0.04
67 0.04
68 0.03
69 0.03
70 0.02
71 0.03
72 0.03
73 0.04
74 0.04
75 0.04
76 0.04
77 0.07
78 0.1
79 0.11
80 0.13
81 0.24
82 0.35
83 0.43
84 0.53
85 0.59
86 0.69
87 0.76
88 0.85
89 0.86
90 0.83
91 0.85
92 0.83
93 0.8
94 0.72
95 0.67
96 0.62
97 0.55
98 0.49
99 0.39
100 0.34
101 0.31
102 0.28
103 0.27
104 0.23
105 0.2
106 0.17
107 0.17
108 0.15
109 0.14
110 0.14
111 0.11
112 0.11
113 0.14
114 0.14
115 0.15
116 0.18
117 0.19
118 0.22
119 0.24
120 0.23
121 0.25
122 0.32
123 0.32
124 0.33
125 0.35
126 0.33
127 0.34
128 0.35
129 0.34
130 0.29
131 0.29
132 0.26
133 0.22
134 0.27
135 0.32
136 0.34
137 0.32
138 0.29
139 0.28
140 0.27
141 0.27
142 0.22
143 0.15
144 0.11
145 0.1