Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5CYY0

Protein Details
Accession A0A5N5CYY0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
81-100VYIICNKNPKHKQRYVHEVWHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
Amino Acid Sequences MFARTLFLAPFRRATVLAAAPRRLLTTATTLAVASRTPFSLWRPRPTAIAASTQQVRGMKVRSSVKKLCEGCKSVRRKGYVYIICNKNPKHKQRYVHEVWHNGDPCDPIKVTAD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.26
3 0.26
4 0.31
5 0.32
6 0.32
7 0.31
8 0.31
9 0.3
10 0.26
11 0.21
12 0.16
13 0.16
14 0.17
15 0.16
16 0.16
17 0.15
18 0.14
19 0.14
20 0.12
21 0.09
22 0.08
23 0.08
24 0.08
25 0.1
26 0.14
27 0.24
28 0.29
29 0.34
30 0.37
31 0.37
32 0.39
33 0.39
34 0.38
35 0.29
36 0.29
37 0.23
38 0.22
39 0.22
40 0.2
41 0.21
42 0.18
43 0.17
44 0.14
45 0.16
46 0.14
47 0.19
48 0.26
49 0.28
50 0.35
51 0.38
52 0.38
53 0.44
54 0.46
55 0.45
56 0.44
57 0.43
58 0.43
59 0.48
60 0.53
61 0.51
62 0.54
63 0.53
64 0.49
65 0.5
66 0.54
67 0.52
68 0.5
69 0.52
70 0.52
71 0.53
72 0.58
73 0.56
74 0.57
75 0.59
76 0.65
77 0.65
78 0.67
79 0.72
80 0.74
81 0.81
82 0.78
83 0.78
84 0.76
85 0.73
86 0.68
87 0.68
88 0.6
89 0.51
90 0.45
91 0.38
92 0.32
93 0.3
94 0.27