Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N5CXT2

Protein Details
Accession A0A5N5CXT2    Localization Confidence High Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
160-186YLERALQKAERKHKRRPNEKRGEGIGSBasic
NLS Segment(s)
PositionSequence
167-189KAERKHKRRPNEKRGEGIGSKAK
Subcellular Location(s) nucl 20, cyto 5
Family & Domain DBs
Amino Acid Sequences MMDINEEESPPPSSEDTTSDNEACSPSPWEDVTSDEENGSPPPSEDVTSLNEKDGLPYFPKAGESESKAAQRLVNEAYLNAFELCRPSHYFMLTDPISEATMQIFKEKNDDAIERLWAIGSNDLEIATVKVYFCKLGSYFRYLIYGPSVSTQDIRTFYDYLERALQKAERKHKRRPNEKRGEGIGSKAKGVMRFLRAALVIADSKAYKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.22
3 0.25
4 0.26
5 0.3
6 0.28
7 0.26
8 0.25
9 0.25
10 0.22
11 0.19
12 0.18
13 0.15
14 0.17
15 0.18
16 0.18
17 0.18
18 0.19
19 0.23
20 0.23
21 0.22
22 0.19
23 0.19
24 0.18
25 0.18
26 0.17
27 0.12
28 0.1
29 0.12
30 0.13
31 0.13
32 0.13
33 0.14
34 0.17
35 0.22
36 0.22
37 0.2
38 0.21
39 0.2
40 0.21
41 0.21
42 0.19
43 0.16
44 0.17
45 0.17
46 0.16
47 0.17
48 0.16
49 0.17
50 0.18
51 0.19
52 0.21
53 0.23
54 0.25
55 0.25
56 0.25
57 0.23
58 0.2
59 0.19
60 0.17
61 0.17
62 0.15
63 0.14
64 0.13
65 0.12
66 0.12
67 0.1
68 0.08
69 0.06
70 0.08
71 0.08
72 0.1
73 0.12
74 0.14
75 0.16
76 0.16
77 0.17
78 0.15
79 0.21
80 0.18
81 0.16
82 0.13
83 0.12
84 0.12
85 0.11
86 0.11
87 0.06
88 0.07
89 0.07
90 0.1
91 0.1
92 0.1
93 0.13
94 0.13
95 0.14
96 0.14
97 0.15
98 0.14
99 0.14
100 0.14
101 0.11
102 0.11
103 0.09
104 0.08
105 0.07
106 0.08
107 0.07
108 0.07
109 0.07
110 0.07
111 0.07
112 0.07
113 0.07
114 0.05
115 0.05
116 0.05
117 0.06
118 0.06
119 0.07
120 0.06
121 0.09
122 0.09
123 0.15
124 0.18
125 0.22
126 0.23
127 0.23
128 0.25
129 0.22
130 0.22
131 0.19
132 0.17
133 0.12
134 0.13
135 0.14
136 0.12
137 0.14
138 0.14
139 0.15
140 0.16
141 0.18
142 0.19
143 0.19
144 0.18
145 0.24
146 0.23
147 0.22
148 0.27
149 0.25
150 0.23
151 0.25
152 0.29
153 0.29
154 0.37
155 0.46
156 0.5
157 0.56
158 0.67
159 0.74
160 0.8
161 0.85
162 0.87
163 0.88
164 0.89
165 0.89
166 0.86
167 0.81
168 0.78
169 0.68
170 0.63
171 0.59
172 0.49
173 0.42
174 0.38
175 0.35
176 0.3
177 0.33
178 0.33
179 0.3
180 0.31
181 0.31
182 0.31
183 0.29
184 0.27
185 0.23
186 0.2
187 0.17
188 0.14
189 0.16