Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5D8D1

Protein Details
Accession A0A5N5D8D1    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-43MPSTKKRRTRLSSTTNLRHKKAAKVTKPTKKSKRPDPSPVPTPHydrophilic
NLS Segment(s)
PositionSequence
6-37KRRTRLSSTTNLRHKKAAKVTKPTKKSKRPDP
Subcellular Location(s) nucl 14, mito 7, cyto 6
Family & Domain DBs
Amino Acid Sequences MPSTKKRRTRLSSTTNLRHKKAAKVTKPTKKSKRPDPSPVPTPPPRAIMHAANAHRFATPFETDECPVCLQELETEVAYTVCGGFDRLIAPLSLTVQC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.83
3 0.81
4 0.74
5 0.72
6 0.66
7 0.64
8 0.65
9 0.66
10 0.64
11 0.68
12 0.76
13 0.78
14 0.83
15 0.85
16 0.85
17 0.85
18 0.85
19 0.85
20 0.86
21 0.84
22 0.86
23 0.84
24 0.81
25 0.78
26 0.73
27 0.69
28 0.62
29 0.59
30 0.51
31 0.46
32 0.39
33 0.35
34 0.34
35 0.27
36 0.27
37 0.27
38 0.27
39 0.24
40 0.24
41 0.22
42 0.19
43 0.18
44 0.16
45 0.14
46 0.13
47 0.13
48 0.14
49 0.16
50 0.17
51 0.18
52 0.19
53 0.16
54 0.14
55 0.14
56 0.11
57 0.09
58 0.1
59 0.1
60 0.1
61 0.1
62 0.1
63 0.09
64 0.09
65 0.09
66 0.08
67 0.06
68 0.05
69 0.05
70 0.06
71 0.06
72 0.07
73 0.08
74 0.08
75 0.09
76 0.09
77 0.1
78 0.1