Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1VIP6

Protein Details
Accession H1VIP6    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
116-145GSYGAKPAVVPRRKKKKKRTVLANGHIREEHydrophilic
NLS Segment(s)
PositionSequence
126-135VPRRKKKKKR
Subcellular Location(s) extr 9, mito 8, cyto 4.5, cyto_nucl 4, nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004600  TFIIH_Tfb4/GTF2H3  
IPR036465  vWFA_dom_sf  
Gene Ontology GO:0000439  C:transcription factor TFIIH core complex  
GO:0005675  C:transcription factor TFIIH holo complex  
GO:0046872  F:metal ion binding  
GO:0006289  P:nucleotide-excision repair  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF03850  Tfb4  
Amino Acid Sequences MNAVFAAAHSQIPIDTLALSGDATFLQQASYITDGTFMQAASPRGLLSYLMFAYAADAEARSSLIPPTHHTVXFRAACFCHGRVVDTGFVCSICLSIFCDVPEGSECLTCGTKLSLGSYGAKPAVVPRRKKKKKRTVLANGHIREETGSAAGTPRPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.07
4 0.07
5 0.07
6 0.07
7 0.06
8 0.06
9 0.05
10 0.05
11 0.05
12 0.05
13 0.05
14 0.06
15 0.06
16 0.08
17 0.09
18 0.09
19 0.09
20 0.1
21 0.1
22 0.1
23 0.1
24 0.08
25 0.08
26 0.11
27 0.12
28 0.12
29 0.12
30 0.11
31 0.11
32 0.11
33 0.11
34 0.08
35 0.09
36 0.08
37 0.08
38 0.08
39 0.07
40 0.07
41 0.07
42 0.07
43 0.04
44 0.04
45 0.04
46 0.05
47 0.05
48 0.04
49 0.05
50 0.06
51 0.07
52 0.08
53 0.11
54 0.16
55 0.18
56 0.19
57 0.19
58 0.22
59 0.22
60 0.23
61 0.23
62 0.17
63 0.19
64 0.2
65 0.2
66 0.2
67 0.18
68 0.17
69 0.16
70 0.18
71 0.16
72 0.14
73 0.14
74 0.11
75 0.11
76 0.09
77 0.08
78 0.07
79 0.04
80 0.04
81 0.05
82 0.06
83 0.07
84 0.07
85 0.09
86 0.08
87 0.1
88 0.1
89 0.1
90 0.1
91 0.09
92 0.1
93 0.1
94 0.11
95 0.1
96 0.09
97 0.09
98 0.1
99 0.1
100 0.12
101 0.12
102 0.13
103 0.17
104 0.16
105 0.18
106 0.17
107 0.16
108 0.15
109 0.19
110 0.28
111 0.32
112 0.41
113 0.5
114 0.61
115 0.72
116 0.83
117 0.88
118 0.89
119 0.92
120 0.94
121 0.94
122 0.94
123 0.94
124 0.93
125 0.92
126 0.83
127 0.75
128 0.64
129 0.53
130 0.43
131 0.32
132 0.24
133 0.14
134 0.12
135 0.09
136 0.11