Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1VEW3

Protein Details
Accession H1VEW3    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
73-98AELNRIRHPKRSKLEHRDGRPRIIKPBasic
NLS Segment(s)
PositionSequence
79-94RHPKRSKLEHRDGRPR
Subcellular Location(s) nucl 19.5, cyto_nucl 14, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MDHLGNDSTGGQQLRTLHVTPDRNSSDIVSYIVEGVNSARILRGSTDDFKQSIIETMTKQVDGLFILAKFMLAELNRIRHPKRSKLEHRDGRPRIIKPLY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.22
3 0.22
4 0.21
5 0.28
6 0.33
7 0.32
8 0.39
9 0.38
10 0.35
11 0.35
12 0.32
13 0.27
14 0.23
15 0.22
16 0.14
17 0.11
18 0.11
19 0.1
20 0.08
21 0.07
22 0.06
23 0.07
24 0.06
25 0.06
26 0.06
27 0.06
28 0.07
29 0.07
30 0.09
31 0.11
32 0.13
33 0.15
34 0.16
35 0.16
36 0.16
37 0.15
38 0.13
39 0.11
40 0.1
41 0.1
42 0.09
43 0.13
44 0.13
45 0.12
46 0.12
47 0.11
48 0.1
49 0.09
50 0.09
51 0.07
52 0.06
53 0.07
54 0.07
55 0.06
56 0.06
57 0.05
58 0.07
59 0.06
60 0.1
61 0.13
62 0.17
63 0.21
64 0.27
65 0.29
66 0.36
67 0.43
68 0.49
69 0.56
70 0.63
71 0.71
72 0.76
73 0.85
74 0.85
75 0.88
76 0.89
77 0.84
78 0.83
79 0.8
80 0.72