Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1V3K6

Protein Details
Accession H1V3K6    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
47-72WLEPRRAHRPLRHRRRPRQGCLRREGBasic
NLS Segment(s)
PositionSequence
51-87PRRAHRPLRHRRRPRQGCLRREGDRAPGPRGLWRRAR
Subcellular Location(s) mito 17, nucl 7.5, cyto_nucl 5
Family & Domain DBs
Amino Acid Sequences XTSYPSSRNTQRRNGVFVYTLHQIHKTNIRSLLGLRLRPQRCLLHLHWLEPRRAHRPLRHRRRPRQGCLRREGDRAPGPRGLWRRARPQGSVKEFSEDNVLFICRHRYEKCPRNIQDFEDTGIRVRRQKSLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.51
3 0.45
4 0.39
5 0.34
6 0.31
7 0.27
8 0.28
9 0.26
10 0.27
11 0.35
12 0.33
13 0.33
14 0.35
15 0.35
16 0.32
17 0.32
18 0.37
19 0.34
20 0.33
21 0.34
22 0.39
23 0.39
24 0.41
25 0.45
26 0.38
27 0.36
28 0.4
29 0.36
30 0.37
31 0.37
32 0.38
33 0.39
34 0.39
35 0.4
36 0.37
37 0.4
38 0.35
39 0.4
40 0.42
41 0.43
42 0.51
43 0.6
44 0.67
45 0.74
46 0.79
47 0.83
48 0.89
49 0.91
50 0.89
51 0.89
52 0.87
53 0.83
54 0.8
55 0.76
56 0.67
57 0.62
58 0.54
59 0.49
60 0.46
61 0.41
62 0.37
63 0.33
64 0.3
65 0.33
66 0.36
67 0.35
68 0.38
69 0.4
70 0.47
71 0.52
72 0.55
73 0.53
74 0.57
75 0.61
76 0.59
77 0.6
78 0.51
79 0.46
80 0.43
81 0.39
82 0.38
83 0.28
84 0.21
85 0.17
86 0.18
87 0.15
88 0.16
89 0.21
90 0.17
91 0.23
92 0.25
93 0.32
94 0.42
95 0.52
96 0.6
97 0.65
98 0.67
99 0.7
100 0.7
101 0.67
102 0.64
103 0.56
104 0.5
105 0.42
106 0.38
107 0.33
108 0.36
109 0.35
110 0.34
111 0.35