Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1V208

Protein Details
Accession H1V208    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
3-26AAKKHVPIVKKRTKLFNRHQSDRFHydrophilic
29-49VDRSWRKPKGIDNRVRRRFRGBasic
NLS Segment(s)
PositionSequence
13-14KR
30-47DRSWRKPKGIDNRVRRRF
Subcellular Location(s) mito 18.5, mito_nucl 11.833, cyto_nucl 4.833, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG chig:CH63R_01983  -  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVAAKKHVPIVKKRTKLFNRHQSDRFMRVDRSWRKPKGIDNRVRRRFRGNTAMPSIGFGSNKKTKYMMPSGHKAFLVSNVNDVNLLLMHNRTYAAEIAHNVSSRKRIDIISRAKQLGVKVTNPKAKVTTEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.77
3 0.81
4 0.82
5 0.82
6 0.81
7 0.81
8 0.79
9 0.78
10 0.74
11 0.71
12 0.65
13 0.58
14 0.52
15 0.48
16 0.55
17 0.54
18 0.58
19 0.61
20 0.6
21 0.62
22 0.63
23 0.67
24 0.68
25 0.7
26 0.7
27 0.71
28 0.78
29 0.82
30 0.83
31 0.76
32 0.73
33 0.68
34 0.65
35 0.64
36 0.58
37 0.54
38 0.53
39 0.52
40 0.43
41 0.39
42 0.33
43 0.24
44 0.2
45 0.14
46 0.16
47 0.21
48 0.22
49 0.22
50 0.21
51 0.21
52 0.26
53 0.32
54 0.33
55 0.32
56 0.38
57 0.4
58 0.4
59 0.39
60 0.34
61 0.27
62 0.26
63 0.25
64 0.18
65 0.18
66 0.17
67 0.17
68 0.16
69 0.16
70 0.11
71 0.07
72 0.07
73 0.05
74 0.05
75 0.06
76 0.06
77 0.07
78 0.07
79 0.08
80 0.09
81 0.09
82 0.1
83 0.11
84 0.13
85 0.15
86 0.16
87 0.16
88 0.17
89 0.22
90 0.22
91 0.23
92 0.22
93 0.23
94 0.29
95 0.37
96 0.45
97 0.48
98 0.53
99 0.51
100 0.5
101 0.5
102 0.45
103 0.45
104 0.39
105 0.37
106 0.4
107 0.47
108 0.53
109 0.52
110 0.54
111 0.48