Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1VW06

Protein Details
Accession H1VW06    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
148-172GDLERFQQRRPRPRRRGDGRRVVVGBasic
NLS Segment(s)
PositionSequence
156-167RRPRPRRRGDGR
Subcellular Location(s) nucl 11.5, cyto_nucl 11, cyto 9.5, mito 5
Family & Domain DBs
Amino Acid Sequences MRSAGGWPSRLHGAPEEGGREGGVQEAGVDVVDDVVELEEQGLRLPPEREVRGDVLGPGPGDAARRGLGGGGGEEVDVAEVGAAPAVELAAADLDGEVDDDVVEVEAPGRRVGPDEGVAVAVGELVVHEGDRDGLVGGGAGREEDRLGDLERFQQRRPRPRRRGDGRRVVVGGGGVHVVCQASHVRQGMLLSRPWHLQFRLLISDITRTLNLELRAAHQVRQGPDRKGHQEESIVATPPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.3
3 0.29
4 0.25
5 0.24
6 0.21
7 0.19
8 0.15
9 0.13
10 0.1
11 0.07
12 0.06
13 0.06
14 0.06
15 0.05
16 0.05
17 0.04
18 0.04
19 0.04
20 0.03
21 0.03
22 0.04
23 0.04
24 0.04
25 0.04
26 0.05
27 0.05
28 0.06
29 0.07
30 0.08
31 0.11
32 0.12
33 0.16
34 0.23
35 0.25
36 0.27
37 0.29
38 0.3
39 0.29
40 0.29
41 0.25
42 0.19
43 0.18
44 0.16
45 0.12
46 0.1
47 0.09
48 0.09
49 0.09
50 0.09
51 0.09
52 0.09
53 0.09
54 0.08
55 0.08
56 0.07
57 0.07
58 0.06
59 0.05
60 0.05
61 0.05
62 0.04
63 0.04
64 0.03
65 0.03
66 0.02
67 0.02
68 0.02
69 0.02
70 0.02
71 0.02
72 0.02
73 0.02
74 0.02
75 0.02
76 0.02
77 0.02
78 0.02
79 0.02
80 0.02
81 0.02
82 0.02
83 0.03
84 0.03
85 0.03
86 0.03
87 0.03
88 0.03
89 0.03
90 0.03
91 0.02
92 0.03
93 0.04
94 0.05
95 0.05
96 0.06
97 0.06
98 0.08
99 0.08
100 0.09
101 0.09
102 0.08
103 0.08
104 0.08
105 0.08
106 0.06
107 0.05
108 0.04
109 0.03
110 0.02
111 0.02
112 0.02
113 0.02
114 0.02
115 0.02
116 0.02
117 0.03
118 0.03
119 0.03
120 0.03
121 0.03
122 0.03
123 0.03
124 0.03
125 0.03
126 0.03
127 0.03
128 0.03
129 0.03
130 0.04
131 0.04
132 0.04
133 0.06
134 0.07
135 0.08
136 0.08
137 0.15
138 0.23
139 0.25
140 0.26
141 0.33
142 0.4
143 0.5
144 0.6
145 0.65
146 0.68
147 0.76
148 0.85
149 0.88
150 0.91
151 0.9
152 0.91
153 0.83
154 0.76
155 0.67
156 0.56
157 0.46
158 0.35
159 0.25
160 0.14
161 0.11
162 0.06
163 0.06
164 0.06
165 0.06
166 0.05
167 0.06
168 0.08
169 0.09
170 0.13
171 0.14
172 0.14
173 0.15
174 0.16
175 0.19
176 0.2
177 0.22
178 0.2
179 0.21
180 0.25
181 0.26
182 0.3
183 0.26
184 0.28
185 0.27
186 0.29
187 0.31
188 0.29
189 0.28
190 0.24
191 0.26
192 0.23
193 0.23
194 0.19
195 0.16
196 0.17
197 0.21
198 0.21
199 0.19
200 0.19
201 0.2
202 0.28
203 0.28
204 0.28
205 0.28
206 0.33
207 0.35
208 0.43
209 0.46
210 0.43
211 0.5
212 0.56
213 0.6
214 0.61
215 0.6
216 0.55
217 0.53
218 0.5
219 0.5
220 0.45