Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1VKT2

Protein Details
Accession H1VKT2    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
17-41YGLFRTTRERCRRKKCGDVRHIKDEBasic
NLS Segment(s)
Subcellular Location(s) nucl 19, mito 4.5, cyto_mito 4.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MMDYMINLSAFSNTEDYGLFRTTRERCRRKKCGDVRHIKDESREHLCLCKCWPGDSESEGSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.11
4 0.12
5 0.13
6 0.12
7 0.11
8 0.17
9 0.22
10 0.32
11 0.42
12 0.49
13 0.58
14 0.68
15 0.78
16 0.78
17 0.83
18 0.83
19 0.83
20 0.84
21 0.84
22 0.81
23 0.79
24 0.75
25 0.66
26 0.62
27 0.55
28 0.49
29 0.45
30 0.39
31 0.32
32 0.35
33 0.36
34 0.33
35 0.32
36 0.35
37 0.3
38 0.31
39 0.32
40 0.28
41 0.31
42 0.32