Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1VQE8

Protein Details
Accession H1VQE8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
52-74FVAPKRGRPSKHKKISRKLLGAHBasic
NLS Segment(s)
PositionSequence
44-70GRRKRRGGGFVAPKRGRPSKHKKISRK
Subcellular Location(s) mito 11, cyto 8, extr 4, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR020796  ORC5  
IPR047088  ORC5_C  
Gene Ontology GO:0005634  C:nucleus  
GO:0000808  C:origin recognition complex  
GO:0006260  P:DNA replication  
Pfam View protein in Pfam  
PF14630  ORC5_C  
Amino Acid Sequences MSTATADLTTLLPTXTRLLLLAAYLASHNAAKHDLVLFSTYHHGRRKRRGGGFVAPKRGRPSKHKKISRKLLGAHAFVLERMLAIFAALRCEWAADDGLAAGSVVDGDVGMAISTLASLRLLMKVGMAGDPMDRGGKWRINVGWDVIRGVGRSLGIEVEEWLVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.1
4 0.1
5 0.09
6 0.09
7 0.09
8 0.09
9 0.07
10 0.06
11 0.06
12 0.07
13 0.08
14 0.08
15 0.09
16 0.1
17 0.1
18 0.11
19 0.12
20 0.12
21 0.11
22 0.13
23 0.11
24 0.11
25 0.17
26 0.18
27 0.23
28 0.3
29 0.37
30 0.44
31 0.55
32 0.63
33 0.67
34 0.7
35 0.71
36 0.69
37 0.71
38 0.73
39 0.69
40 0.69
41 0.61
42 0.58
43 0.57
44 0.57
45 0.52
46 0.52
47 0.56
48 0.57
49 0.67
50 0.74
51 0.77
52 0.82
53 0.88
54 0.86
55 0.81
56 0.73
57 0.71
58 0.65
59 0.56
60 0.46
61 0.36
62 0.28
63 0.22
64 0.19
65 0.1
66 0.05
67 0.04
68 0.04
69 0.03
70 0.03
71 0.04
72 0.04
73 0.06
74 0.06
75 0.06
76 0.06
77 0.06
78 0.06
79 0.06
80 0.07
81 0.04
82 0.05
83 0.04
84 0.04
85 0.04
86 0.04
87 0.03
88 0.02
89 0.02
90 0.02
91 0.02
92 0.02
93 0.02
94 0.02
95 0.02
96 0.02
97 0.02
98 0.02
99 0.02
100 0.02
101 0.03
102 0.03
103 0.03
104 0.03
105 0.04
106 0.05
107 0.06
108 0.06
109 0.06
110 0.07
111 0.07
112 0.07
113 0.07
114 0.07
115 0.06
116 0.07
117 0.08
118 0.08
119 0.07
120 0.1
121 0.16
122 0.19
123 0.2
124 0.25
125 0.26
126 0.28
127 0.3
128 0.31
129 0.3
130 0.27
131 0.27
132 0.23
133 0.22
134 0.19
135 0.18
136 0.16
137 0.12
138 0.11
139 0.11
140 0.1
141 0.1
142 0.1
143 0.1