Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1VWV5

Protein Details
Accession H1VWV5    Localization Confidence Low Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MSLGPQCWRCRKRRLRCDSSLPSCHKCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, extr 6, nucl 5.5, cyto_nucl 5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MSLGPQCWRCRKRRLRCDSSLPSCHKCLAADVHCPGYGDKKPVAWRDPLVLTNRGVVRIRDPKETKTSSPSAPASVLGIVCRSPRTASSEMDLRIAADAIEYFAPDLAPYATTPSPFQVSLRQVGELAVYLRNAYISIAALHRHVSGEPSVLFRLAANDNRVSPRSVARSHARSEAAAAGDSDLLCLIRMGDFKSVHFASQAAAFKALGEELHRYQPGGLTDDFGPSIFLGIIVMLSSQVTACP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.87
3 0.87
4 0.9
5 0.89
6 0.87
7 0.85
8 0.81
9 0.75
10 0.67
11 0.61
12 0.52
13 0.42
14 0.37
15 0.36
16 0.33
17 0.35
18 0.35
19 0.36
20 0.35
21 0.35
22 0.31
23 0.3
24 0.29
25 0.27
26 0.26
27 0.28
28 0.35
29 0.4
30 0.43
31 0.41
32 0.39
33 0.39
34 0.41
35 0.4
36 0.38
37 0.34
38 0.31
39 0.32
40 0.31
41 0.3
42 0.28
43 0.25
44 0.28
45 0.34
46 0.37
47 0.41
48 0.43
49 0.44
50 0.51
51 0.55
52 0.5
53 0.47
54 0.48
55 0.4
56 0.43
57 0.39
58 0.32
59 0.28
60 0.26
61 0.2
62 0.17
63 0.16
64 0.1
65 0.1
66 0.09
67 0.09
68 0.1
69 0.1
70 0.09
71 0.11
72 0.17
73 0.2
74 0.2
75 0.22
76 0.25
77 0.25
78 0.25
79 0.23
80 0.16
81 0.14
82 0.13
83 0.1
84 0.05
85 0.04
86 0.04
87 0.04
88 0.04
89 0.04
90 0.04
91 0.04
92 0.04
93 0.04
94 0.04
95 0.04
96 0.04
97 0.08
98 0.08
99 0.09
100 0.1
101 0.1
102 0.12
103 0.11
104 0.12
105 0.14
106 0.15
107 0.18
108 0.19
109 0.18
110 0.16
111 0.16
112 0.15
113 0.1
114 0.09
115 0.06
116 0.06
117 0.06
118 0.05
119 0.05
120 0.05
121 0.05
122 0.04
123 0.04
124 0.05
125 0.06
126 0.07
127 0.07
128 0.08
129 0.08
130 0.08
131 0.08
132 0.09
133 0.08
134 0.1
135 0.1
136 0.11
137 0.11
138 0.1
139 0.1
140 0.09
141 0.11
142 0.13
143 0.15
144 0.16
145 0.17
146 0.19
147 0.22
148 0.23
149 0.21
150 0.2
151 0.21
152 0.24
153 0.24
154 0.28
155 0.33
156 0.36
157 0.37
158 0.4
159 0.36
160 0.31
161 0.31
162 0.28
163 0.22
164 0.18
165 0.15
166 0.11
167 0.11
168 0.1
169 0.09
170 0.06
171 0.06
172 0.05
173 0.05
174 0.05
175 0.06
176 0.07
177 0.09
178 0.14
179 0.15
180 0.15
181 0.22
182 0.22
183 0.21
184 0.2
185 0.19
186 0.14
187 0.2
188 0.22
189 0.17
190 0.17
191 0.17
192 0.16
193 0.17
194 0.16
195 0.1
196 0.1
197 0.14
198 0.15
199 0.21
200 0.21
201 0.21
202 0.21
203 0.24
204 0.24
205 0.23
206 0.21
207 0.18
208 0.19
209 0.2
210 0.2
211 0.16
212 0.15
213 0.11
214 0.11
215 0.08
216 0.08
217 0.06
218 0.05
219 0.05
220 0.05
221 0.05
222 0.04
223 0.04
224 0.05