Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H1VK73

Protein Details
Accession H1VK73    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
11-35VDSTVKSFERQKQRKISPLPLHLKEHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 20.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000559  Formate_THF_ligase  
IPR020628  Formate_THF_ligase_CS  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0005524  F:ATP binding  
GO:0004329  F:formate-tetrahydrofolate ligase activity  
GO:0004477  F:methenyltetrahydrofolate cyclohydrolase activity  
GO:0004488  F:methylenetetrahydrofolate dehydrogenase (NADP+) activity  
GO:0046656  P:folic acid biosynthetic process  
GO:0006139  P:nucleobase-containing compound metabolic process  
GO:0035999  P:tetrahydrofolate interconversion  
Pfam View protein in Pfam  
PF01268  FTHFS  
PROSITE View protein in PROSITE  
PS00721  FTHFS_1  
PS00722  FTHFS_2  
CDD cd00477  FTHFS  
Amino Acid Sequences MTVAMLLSNVVDSTVKSFERQKQRKISPLPLHLKEPVPSDIEVSRSQNPKQITRLAKEVGIASHELEPYGAYKAKVDLSLLKRLDHRRNGKYVVVTGITPTPLGEGKSTTTMGIAQALGAHLGRVTFANVRQPSQGPTFGIKGGAAGGGYSQVIPMDEFNLHLTGDIHAITAANNLLAAAIETRMFHENTQKDGPLYKRLVPAKNGKRVFAPVMAPRLKKLGIEKTNPDDLTEEEIRRFARLDIDPETITWRRVLDVNDRHLRGITVGAAPTEKGHTRETGFDISVASECMAILALSTDLADMRRRLGSMVVASSRSGDPVTCDDIGAGGALTALMRDAIKPNLMQTLEGTPVFVHAGPFANISVGNSSILADKMALKIVGTEPDEDHVEKAGFVVTEAGFDFTMGGERFFNIKCRASGLVPDVVVVVATVRALKVHGGGPPIAPGAPLNAVYKQENVDILRAGCVNLKKHIENAKSYGIPVVVAINKFVTDTDAEIAVIREEAIAAGAEDAILSNHWAEGGKGAIELGKGVIAASEKPKDFKLLYDLEGSVQERIEAIGKKMYGAAAVEFSELAQKKVDTYTKQGFGNLPICVAKTQYSLSHDPDLKGAPTGFTVPIRDVRMAAGAGYLYALAADIQTIPGLPTAPGYLNVDVDTETGEIDGLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.18
4 0.26
5 0.35
6 0.46
7 0.55
8 0.61
9 0.68
10 0.75
11 0.82
12 0.82
13 0.84
14 0.82
15 0.83
16 0.83
17 0.76
18 0.72
19 0.67
20 0.62
21 0.54
22 0.49
23 0.42
24 0.35
25 0.31
26 0.3
27 0.27
28 0.28
29 0.29
30 0.29
31 0.33
32 0.36
33 0.38
34 0.4
35 0.43
36 0.45
37 0.47
38 0.52
39 0.52
40 0.51
41 0.56
42 0.52
43 0.48
44 0.44
45 0.4
46 0.33
47 0.27
48 0.23
49 0.19
50 0.2
51 0.19
52 0.17
53 0.15
54 0.14
55 0.13
56 0.16
57 0.16
58 0.13
59 0.14
60 0.17
61 0.19
62 0.2
63 0.2
64 0.25
65 0.27
66 0.36
67 0.36
68 0.36
69 0.42
70 0.5
71 0.57
72 0.59
73 0.64
74 0.62
75 0.69
76 0.7
77 0.67
78 0.61
79 0.54
80 0.48
81 0.4
82 0.33
83 0.27
84 0.25
85 0.2
86 0.17
87 0.14
88 0.12
89 0.12
90 0.13
91 0.13
92 0.12
93 0.14
94 0.17
95 0.18
96 0.16
97 0.15
98 0.14
99 0.14
100 0.14
101 0.11
102 0.08
103 0.08
104 0.08
105 0.08
106 0.07
107 0.07
108 0.05
109 0.05
110 0.06
111 0.06
112 0.08
113 0.1
114 0.12
115 0.21
116 0.23
117 0.24
118 0.27
119 0.28
120 0.3
121 0.31
122 0.32
123 0.26
124 0.27
125 0.27
126 0.24
127 0.24
128 0.19
129 0.15
130 0.13
131 0.11
132 0.08
133 0.06
134 0.05
135 0.05
136 0.06
137 0.05
138 0.05
139 0.05
140 0.05
141 0.06
142 0.06
143 0.07
144 0.07
145 0.08
146 0.09
147 0.1
148 0.09
149 0.1
150 0.1
151 0.09
152 0.09
153 0.09
154 0.07
155 0.07
156 0.07
157 0.07
158 0.07
159 0.06
160 0.05
161 0.05
162 0.05
163 0.05
164 0.04
165 0.05
166 0.04
167 0.04
168 0.05
169 0.05
170 0.08
171 0.1
172 0.11
173 0.12
174 0.2
175 0.21
176 0.26
177 0.29
178 0.27
179 0.26
180 0.3
181 0.32
182 0.31
183 0.33
184 0.32
185 0.37
186 0.42
187 0.46
188 0.46
189 0.54
190 0.55
191 0.62
192 0.59
193 0.53
194 0.48
195 0.48
196 0.44
197 0.37
198 0.32
199 0.26
200 0.33
201 0.37
202 0.35
203 0.33
204 0.33
205 0.3
206 0.28
207 0.3
208 0.32
209 0.34
210 0.38
211 0.42
212 0.44
213 0.49
214 0.47
215 0.42
216 0.33
217 0.27
218 0.29
219 0.27
220 0.23
221 0.18
222 0.2
223 0.19
224 0.19
225 0.19
226 0.13
227 0.16
228 0.16
229 0.19
230 0.21
231 0.23
232 0.23
233 0.22
234 0.27
235 0.22
236 0.21
237 0.18
238 0.15
239 0.13
240 0.16
241 0.18
242 0.23
243 0.28
244 0.35
245 0.41
246 0.41
247 0.4
248 0.38
249 0.35
250 0.26
251 0.21
252 0.14
253 0.09
254 0.09
255 0.09
256 0.08
257 0.08
258 0.08
259 0.1
260 0.1
261 0.11
262 0.12
263 0.14
264 0.15
265 0.18
266 0.2
267 0.2
268 0.19
269 0.16
270 0.15
271 0.14
272 0.13
273 0.1
274 0.07
275 0.05
276 0.05
277 0.04
278 0.04
279 0.03
280 0.03
281 0.03
282 0.03
283 0.03
284 0.03
285 0.03
286 0.03
287 0.04
288 0.06
289 0.06
290 0.08
291 0.09
292 0.09
293 0.09
294 0.1
295 0.1
296 0.09
297 0.11
298 0.1
299 0.1
300 0.1
301 0.11
302 0.11
303 0.1
304 0.09
305 0.07
306 0.08
307 0.1
308 0.12
309 0.11
310 0.11
311 0.1
312 0.1
313 0.1
314 0.08
315 0.06
316 0.03
317 0.02
318 0.02
319 0.02
320 0.02
321 0.02
322 0.02
323 0.03
324 0.03
325 0.05
326 0.06
327 0.07
328 0.07
329 0.08
330 0.11
331 0.11
332 0.11
333 0.1
334 0.12
335 0.12
336 0.12
337 0.12
338 0.08
339 0.08
340 0.09
341 0.08
342 0.06
343 0.05
344 0.07
345 0.07
346 0.07
347 0.07
348 0.07
349 0.06
350 0.06
351 0.06
352 0.06
353 0.06
354 0.05
355 0.06
356 0.06
357 0.06
358 0.06
359 0.06
360 0.06
361 0.06
362 0.07
363 0.06
364 0.06
365 0.07
366 0.07
367 0.1
368 0.1
369 0.11
370 0.1
371 0.12
372 0.13
373 0.13
374 0.12
375 0.1
376 0.1
377 0.08
378 0.08
379 0.08
380 0.06
381 0.06
382 0.07
383 0.06
384 0.07
385 0.07
386 0.08
387 0.07
388 0.07
389 0.07
390 0.05
391 0.08
392 0.07
393 0.08
394 0.07
395 0.08
396 0.1
397 0.11
398 0.16
399 0.17
400 0.18
401 0.18
402 0.2
403 0.22
404 0.2
405 0.23
406 0.21
407 0.19
408 0.17
409 0.17
410 0.14
411 0.12
412 0.11
413 0.08
414 0.06
415 0.03
416 0.03
417 0.03
418 0.03
419 0.04
420 0.04
421 0.05
422 0.06
423 0.08
424 0.1
425 0.11
426 0.12
427 0.12
428 0.13
429 0.13
430 0.11
431 0.09
432 0.07
433 0.07
434 0.08
435 0.09
436 0.1
437 0.11
438 0.13
439 0.14
440 0.15
441 0.15
442 0.15
443 0.16
444 0.16
445 0.15
446 0.15
447 0.14
448 0.14
449 0.13
450 0.12
451 0.13
452 0.16
453 0.17
454 0.21
455 0.25
456 0.24
457 0.3
458 0.38
459 0.38
460 0.38
461 0.4
462 0.4
463 0.36
464 0.36
465 0.31
466 0.23
467 0.19
468 0.16
469 0.15
470 0.12
471 0.12
472 0.12
473 0.11
474 0.11
475 0.11
476 0.11
477 0.09
478 0.07
479 0.08
480 0.09
481 0.09
482 0.09
483 0.09
484 0.09
485 0.08
486 0.07
487 0.06
488 0.05
489 0.04
490 0.04
491 0.04
492 0.04
493 0.04
494 0.04
495 0.04
496 0.04
497 0.03
498 0.04
499 0.03
500 0.04
501 0.04
502 0.04
503 0.04
504 0.05
505 0.05
506 0.05
507 0.06
508 0.07
509 0.07
510 0.07
511 0.07
512 0.07
513 0.07
514 0.07
515 0.06
516 0.05
517 0.05
518 0.05
519 0.06
520 0.06
521 0.08
522 0.13
523 0.18
524 0.19
525 0.21
526 0.22
527 0.26
528 0.25
529 0.25
530 0.27
531 0.26
532 0.27
533 0.28
534 0.28
535 0.24
536 0.27
537 0.25
538 0.2
539 0.16
540 0.14
541 0.11
542 0.11
543 0.15
544 0.14
545 0.15
546 0.18
547 0.18
548 0.19
549 0.19
550 0.19
551 0.15
552 0.14
553 0.13
554 0.1
555 0.11
556 0.11
557 0.1
558 0.1
559 0.16
560 0.16
561 0.16
562 0.16
563 0.16
564 0.17
565 0.23
566 0.29
567 0.25
568 0.33
569 0.4
570 0.43
571 0.43
572 0.45
573 0.41
574 0.41
575 0.41
576 0.33
577 0.28
578 0.24
579 0.24
580 0.22
581 0.22
582 0.18
583 0.16
584 0.18
585 0.2
586 0.26
587 0.29
588 0.33
589 0.39
590 0.41
591 0.39
592 0.4
593 0.38
594 0.32
595 0.31
596 0.27
597 0.2
598 0.18
599 0.2
600 0.19
601 0.18
602 0.2
603 0.2
604 0.25
605 0.27
606 0.27
607 0.25
608 0.23
609 0.24
610 0.22
611 0.19
612 0.14
613 0.11
614 0.1
615 0.09
616 0.08
617 0.05
618 0.05
619 0.05
620 0.04
621 0.04
622 0.04
623 0.05
624 0.05
625 0.05
626 0.06
627 0.06
628 0.07
629 0.08
630 0.08
631 0.09
632 0.11
633 0.12
634 0.14
635 0.18
636 0.18
637 0.18
638 0.19
639 0.18
640 0.16
641 0.15
642 0.14
643 0.1
644 0.09
645 0.08