Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H1V0W1

Protein Details
Accession H1V0W1    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
33-57DTSAGKEKKRKAKGQCKNQNQRGDWHydrophilic
NLS Segment(s)
PositionSequence
37-45GKEKKRKAK
Subcellular Location(s) nucl 10, mito 8, extr 6, cyto 1, plas 1, pero 1, cyto_pero 1
Family & Domain DBs
Amino Acid Sequences HKELESQDRSRKHICLFAASLLLAKPSQGRDRDTSAGKEKKRKAKGQCKNQNQRGDWASFRSLSLATRARPLNPGISCPSCCICISAEALVRCSSQSCVQTADVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.4
3 0.38
4 0.33
5 0.3
6 0.26
7 0.23
8 0.17
9 0.17
10 0.11
11 0.09
12 0.1
13 0.13
14 0.19
15 0.22
16 0.26
17 0.28
18 0.33
19 0.37
20 0.37
21 0.38
22 0.41
23 0.46
24 0.47
25 0.53
26 0.56
27 0.61
28 0.67
29 0.7
30 0.72
31 0.75
32 0.8
33 0.82
34 0.85
35 0.86
36 0.88
37 0.87
38 0.84
39 0.74
40 0.69
41 0.61
42 0.53
43 0.43
44 0.35
45 0.29
46 0.21
47 0.2
48 0.16
49 0.14
50 0.12
51 0.16
52 0.16
53 0.16
54 0.21
55 0.22
56 0.22
57 0.24
58 0.25
59 0.27
60 0.24
61 0.26
62 0.27
63 0.29
64 0.29
65 0.29
66 0.29
67 0.24
68 0.24
69 0.22
70 0.17
71 0.16
72 0.17
73 0.18
74 0.21
75 0.2
76 0.21
77 0.21
78 0.21
79 0.19
80 0.18
81 0.18
82 0.19
83 0.21
84 0.21
85 0.23