Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1VQQ2

Protein Details
Accession H1VQQ2    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
25-50PPSDRPKTPNTPKTPKTPKTPANPNVHydrophilic
NLS Segment(s)
PositionSequence
150-163EERRREAARRKREE
Subcellular Location(s) nucl 15, cyto_nucl 13, cyto 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR013960  DASH_Duo1  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0042729  C:DASH complex  
GO:0005874  C:microtubule  
GO:0072686  C:mitotic spindle  
GO:0051301  P:cell division  
GO:0007059  P:chromosome segregation  
GO:0000278  P:mitotic cell cycle  
KEGG chig:CH63R_14089  -  
Pfam View protein in Pfam  
PF08651  DASH_Duo1  
Amino Acid Sequences MADYTDDSLTEDVWASPRPEGESAPPSDRPKTPNTPKTPKTPKTPANPNVTFDREAALRKELEGVRNINAAIEGIIATLDKAKGNMNTVGGTVSNASTLLNTWTRILSQTEHNQRLILNPNWRGASNDLVEIEAEAVQKQQLAERRAAEEERRREAARRKREEEEEERQRQAAVGNAPRGRVVSRGRARGTASTTRGHGYTSSTSRIGRGAASIRGGYRGRARGTE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.15
4 0.17
5 0.19
6 0.2
7 0.21
8 0.25
9 0.28
10 0.31
11 0.34
12 0.39
13 0.4
14 0.43
15 0.45
16 0.44
17 0.46
18 0.52
19 0.58
20 0.62
21 0.67
22 0.73
23 0.73
24 0.8
25 0.83
26 0.79
27 0.77
28 0.77
29 0.75
30 0.75
31 0.81
32 0.78
33 0.77
34 0.73
35 0.67
36 0.62
37 0.58
38 0.5
39 0.4
40 0.34
41 0.26
42 0.26
43 0.25
44 0.22
45 0.18
46 0.17
47 0.22
48 0.22
49 0.23
50 0.25
51 0.24
52 0.23
53 0.24
54 0.23
55 0.17
56 0.15
57 0.13
58 0.08
59 0.06
60 0.05
61 0.04
62 0.04
63 0.03
64 0.03
65 0.05
66 0.05
67 0.05
68 0.06
69 0.08
70 0.09
71 0.12
72 0.13
73 0.13
74 0.13
75 0.13
76 0.13
77 0.11
78 0.1
79 0.08
80 0.06
81 0.05
82 0.05
83 0.05
84 0.04
85 0.05
86 0.07
87 0.08
88 0.08
89 0.09
90 0.09
91 0.09
92 0.11
93 0.11
94 0.11
95 0.14
96 0.22
97 0.29
98 0.31
99 0.31
100 0.3
101 0.29
102 0.3
103 0.31
104 0.27
105 0.25
106 0.25
107 0.27
108 0.27
109 0.27
110 0.26
111 0.22
112 0.22
113 0.17
114 0.15
115 0.13
116 0.12
117 0.12
118 0.1
119 0.09
120 0.07
121 0.06
122 0.05
123 0.05
124 0.05
125 0.06
126 0.06
127 0.09
128 0.14
129 0.16
130 0.19
131 0.2
132 0.22
133 0.24
134 0.26
135 0.3
136 0.32
137 0.36
138 0.37
139 0.39
140 0.38
141 0.43
142 0.51
143 0.54
144 0.56
145 0.6
146 0.61
147 0.63
148 0.68
149 0.7
150 0.68
151 0.68
152 0.67
153 0.63
154 0.59
155 0.53
156 0.47
157 0.4
158 0.33
159 0.27
160 0.24
161 0.24
162 0.3
163 0.31
164 0.31
165 0.31
166 0.31
167 0.27
168 0.27
169 0.26
170 0.3
171 0.36
172 0.43
173 0.45
174 0.47
175 0.49
176 0.47
177 0.49
178 0.46
179 0.42
180 0.37
181 0.37
182 0.36
183 0.34
184 0.3
185 0.25
186 0.22
187 0.25
188 0.26
189 0.28
190 0.29
191 0.29
192 0.29
193 0.3
194 0.26
195 0.2
196 0.2
197 0.2
198 0.2
199 0.23
200 0.23
201 0.23
202 0.28
203 0.28
204 0.28
205 0.32
206 0.35