Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1VMQ9

Protein Details
Accession H1VMQ9    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
17-36ASTSRRSGRVRKPTAKVRVVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 10.5, mito 5, cyto 3, plas 3
Family & Domain DBs
Amino Acid Sequences MAVSLDAGPSITVHGDASTSRRSGRVRKPTAKVRVVEQVSYQDNAELKDEINKLSNLVQDLLRRDAEREQFLKDCLMKIESLEKELQEEKQRSDRHQRGLARSMHA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.08
4 0.12
5 0.14
6 0.15
7 0.16
8 0.21
9 0.25
10 0.34
11 0.43
12 0.5
13 0.57
14 0.64
15 0.71
16 0.76
17 0.81
18 0.78
19 0.69
20 0.61
21 0.6
22 0.53
23 0.46
24 0.38
25 0.33
26 0.28
27 0.27
28 0.24
29 0.16
30 0.15
31 0.15
32 0.15
33 0.11
34 0.09
35 0.13
36 0.14
37 0.13
38 0.14
39 0.13
40 0.13
41 0.14
42 0.15
43 0.11
44 0.11
45 0.12
46 0.13
47 0.15
48 0.17
49 0.17
50 0.16
51 0.17
52 0.2
53 0.22
54 0.25
55 0.24
56 0.25
57 0.25
58 0.26
59 0.28
60 0.24
61 0.21
62 0.18
63 0.18
64 0.15
65 0.15
66 0.22
67 0.19
68 0.21
69 0.21
70 0.2
71 0.22
72 0.24
73 0.27
74 0.29
75 0.31
76 0.33
77 0.4
78 0.44
79 0.48
80 0.57
81 0.6
82 0.59
83 0.65
84 0.67
85 0.66
86 0.7