Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1UXN6

Protein Details
Accession H1UXN6    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
149-178GEVKRKKAASASKKSKRKYRQLEEEKAQGEHydrophilic
NLS Segment(s)
PositionSequence
152-167KRKKAASASKKSKRKY
Subcellular Location(s) mito 22, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000352  Pep_chain_release_fac_I  
IPR045853  Pep_chain_release_fac_I_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003747  F:translation release factor activity  
Pfam View protein in Pfam  
PF00472  RF-1  
Amino Acid Sequences MPPPLSLPLLTRLAHRAGAAASTVGANALMRCRSVTARPAPQHRYRLPLVAFFSASPSAALKKHEMPPRPRPPPDSDIEESYLKGSGPGGQKINKTSSAVQLKHIPTGIVVKSQATRSRTQNRKIAREILAQKIDDLQNGEQSRSAIVGEVKRKKAASASKKSKRKYRQLEEEKAQGETAERTDRC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.25
3 0.21
4 0.16
5 0.17
6 0.15
7 0.11
8 0.09
9 0.08
10 0.08
11 0.06
12 0.06
13 0.06
14 0.06
15 0.09
16 0.1
17 0.1
18 0.11
19 0.13
20 0.16
21 0.19
22 0.26
23 0.3
24 0.39
25 0.45
26 0.53
27 0.59
28 0.63
29 0.68
30 0.63
31 0.62
32 0.54
33 0.54
34 0.47
35 0.44
36 0.39
37 0.32
38 0.3
39 0.24
40 0.25
41 0.18
42 0.17
43 0.13
44 0.11
45 0.11
46 0.12
47 0.14
48 0.15
49 0.2
50 0.27
51 0.33
52 0.4
53 0.45
54 0.54
55 0.63
56 0.67
57 0.65
58 0.63
59 0.63
60 0.6
61 0.57
62 0.53
63 0.45
64 0.4
65 0.39
66 0.35
67 0.28
68 0.24
69 0.2
70 0.13
71 0.11
72 0.08
73 0.1
74 0.12
75 0.14
76 0.17
77 0.19
78 0.21
79 0.23
80 0.25
81 0.21
82 0.21
83 0.2
84 0.25
85 0.29
86 0.29
87 0.28
88 0.33
89 0.32
90 0.31
91 0.3
92 0.23
93 0.16
94 0.19
95 0.17
96 0.12
97 0.12
98 0.12
99 0.13
100 0.17
101 0.21
102 0.21
103 0.25
104 0.31
105 0.42
106 0.48
107 0.53
108 0.57
109 0.59
110 0.62
111 0.62
112 0.6
113 0.53
114 0.54
115 0.52
116 0.52
117 0.48
118 0.41
119 0.37
120 0.35
121 0.32
122 0.25
123 0.24
124 0.18
125 0.21
126 0.22
127 0.23
128 0.19
129 0.19
130 0.18
131 0.15
132 0.15
133 0.09
134 0.12
135 0.18
136 0.26
137 0.34
138 0.36
139 0.39
140 0.4
141 0.39
142 0.44
143 0.48
144 0.5
145 0.53
146 0.61
147 0.68
148 0.77
149 0.84
150 0.86
151 0.86
152 0.87
153 0.86
154 0.86
155 0.87
156 0.89
157 0.91
158 0.87
159 0.84
160 0.75
161 0.65
162 0.54
163 0.43
164 0.35
165 0.27
166 0.25