Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q8SSA2

Protein Details
Accession Q8SSA2    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
5-50LIHKGATYKTRSNRRRKVRTPSGKLVNRRVKKHSKKHRCHECNAILHydrophilic
NLS Segment(s)
PositionSequence
14-41TRSNRRRKVRTPSGKLVNRRVKKHSKKH
Subcellular Location(s) mito 15.5, mito_nucl 12, nucl 7.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
IPR018065  Ribosomal_L34e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ecu:ECU03_0710  -  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
PROSITE View protein in PROSITE  
PS01145  RIBOSOMAL_L34E  
Amino Acid Sequences MKNVLIHKGATYKTRSNRRRKVRTPSGKLVNRRVKKHSKKHRCHECNAILGSIARMRPAEFSRQKVSARRVNRPYGATTCGRCVREKIISAFLGNEERIVMEKTGAAAGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.63
3 0.69
4 0.77
5 0.82
6 0.87
7 0.88
8 0.89
9 0.9
10 0.91
11 0.89
12 0.88
13 0.87
14 0.84
15 0.82
16 0.81
17 0.81
18 0.77
19 0.73
20 0.73
21 0.73
22 0.77
23 0.8
24 0.81
25 0.82
26 0.85
27 0.9
28 0.93
29 0.88
30 0.82
31 0.81
32 0.74
33 0.68
34 0.58
35 0.47
36 0.36
37 0.29
38 0.25
39 0.17
40 0.13
41 0.08
42 0.08
43 0.08
44 0.1
45 0.12
46 0.2
47 0.22
48 0.27
49 0.3
50 0.33
51 0.36
52 0.39
53 0.45
54 0.43
55 0.46
56 0.51
57 0.53
58 0.56
59 0.56
60 0.53
61 0.5
62 0.45
63 0.43
64 0.38
65 0.33
66 0.34
67 0.36
68 0.36
69 0.33
70 0.33
71 0.34
72 0.36
73 0.39
74 0.36
75 0.35
76 0.34
77 0.33
78 0.31
79 0.28
80 0.25
81 0.21
82 0.18
83 0.12
84 0.12
85 0.13
86 0.14
87 0.13
88 0.1
89 0.11
90 0.12