Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1VZ76

Protein Details
Accession H1VZ76   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MKRGGRLCKKLKKKNVDVLDYCHydrophilic
33-114YRNWRRGWACHKCKRPTQRSPRCICGHVVCRRCSCLKSQPPKKKKKHGVYSAIKNTKWTQKDKPTPRKKKQHNPQSLLRVPVHydrophilic
NLS Segment(s)
PositionSequence
72-102PPKKKKKHGVYSAIKNTKWTQKDKPTPRKKK
Subcellular Location(s) nucl 14.5, mito_nucl 13.166, mito 10.5, cyto_nucl 9.333
Family & Domain DBs
Amino Acid Sequences MKRGGRLCKKLKKKNVDVLDYCNWDSPWGYCLYRNWRRGWACHKCKRPTQRSPRCICGHVVCRRCSCLKSQPPKKKKKHGVYSAIKNTKWTQKDKPTPRKKKQHNPQSLLRVPVFNPSIGDWV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.88
3 0.86
4 0.78
5 0.75
6 0.7
7 0.64
8 0.55
9 0.47
10 0.38
11 0.3
12 0.27
13 0.21
14 0.17
15 0.16
16 0.16
17 0.17
18 0.22
19 0.32
20 0.4
21 0.44
22 0.44
23 0.49
24 0.51
25 0.55
26 0.59
27 0.6
28 0.62
29 0.66
30 0.73
31 0.7
32 0.77
33 0.81
34 0.8
35 0.8
36 0.81
37 0.83
38 0.83
39 0.82
40 0.82
41 0.74
42 0.66
43 0.57
44 0.52
45 0.49
46 0.47
47 0.47
48 0.42
49 0.4
50 0.41
51 0.41
52 0.36
53 0.33
54 0.35
55 0.4
56 0.48
57 0.57
58 0.65
59 0.74
60 0.84
61 0.88
62 0.89
63 0.9
64 0.89
65 0.89
66 0.88
67 0.88
68 0.86
69 0.87
70 0.86
71 0.82
72 0.71
73 0.64
74 0.59
75 0.57
76 0.53
77 0.5
78 0.49
79 0.53
80 0.64
81 0.72
82 0.79
83 0.82
84 0.87
85 0.92
86 0.93
87 0.93
88 0.94
89 0.94
90 0.94
91 0.94
92 0.89
93 0.88
94 0.87
95 0.81
96 0.75
97 0.66
98 0.58
99 0.47
100 0.48
101 0.41
102 0.31
103 0.28