Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1VAT2

Protein Details
Accession H1VAT2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
333-355SMNQARRKEKEARKERALNKAKAHydrophilic
NLS Segment(s)
PositionSequence
341-359RRKEKEARKERALNKAKAI
Subcellular Location(s) mito 20, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006073  GTP-bd  
IPR023179  GTP-bd_ortho_bundle_sf  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005525  F:GTP binding  
Pfam View protein in Pfam  
PF01926  MMR_HSR1  
Amino Acid Sequences MLPTAARWAFAPRLHFAVSESIPRSYYLGHHHAALREISSRLSDVGLVLECRDYRVPITSWNPVLDRAIAGRERIVVYTHRDLGADSPXXXEHALRRFHRGHSVVGGTPQRVIFWRKDDPASTKQLLSEIRSVAHSVDSLTGMRALVVGMPNVGKSTLLNKLRVHGMHKKPNVARVGAQPGVTRKLGSPVRILDSEGDGGMGLGEGVFVLDTPGVFMPYVSEAENMVKLALVGSVKDDRIPMEILADYLLYRLNLTDPSAYAKYSEPTNEVNDLLLGVARKTGKLKAGGEANADSAADWIIKQWRAGNLGKFVLDDISDEAFKEKELAREGQGPLSMNQARRKEKEARKERALNKAKAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.31
3 0.27
4 0.29
5 0.28
6 0.31
7 0.3
8 0.28
9 0.27
10 0.28
11 0.27
12 0.22
13 0.24
14 0.25
15 0.28
16 0.28
17 0.3
18 0.33
19 0.34
20 0.35
21 0.32
22 0.26
23 0.23
24 0.23
25 0.21
26 0.19
27 0.18
28 0.15
29 0.15
30 0.13
31 0.1
32 0.12
33 0.12
34 0.11
35 0.11
36 0.13
37 0.12
38 0.15
39 0.16
40 0.15
41 0.15
42 0.19
43 0.19
44 0.24
45 0.29
46 0.32
47 0.33
48 0.35
49 0.34
50 0.31
51 0.32
52 0.25
53 0.21
54 0.16
55 0.19
56 0.17
57 0.17
58 0.16
59 0.17
60 0.17
61 0.17
62 0.18
63 0.16
64 0.21
65 0.25
66 0.26
67 0.24
68 0.24
69 0.23
70 0.23
71 0.25
72 0.2
73 0.16
74 0.17
75 0.19
76 0.2
77 0.2
78 0.23
79 0.2
80 0.28
81 0.3
82 0.3
83 0.37
84 0.37
85 0.38
86 0.38
87 0.39
88 0.3
89 0.33
90 0.33
91 0.25
92 0.24
93 0.22
94 0.19
95 0.19
96 0.22
97 0.19
98 0.23
99 0.28
100 0.29
101 0.32
102 0.34
103 0.38
104 0.39
105 0.43
106 0.39
107 0.34
108 0.31
109 0.33
110 0.31
111 0.27
112 0.25
113 0.19
114 0.18
115 0.18
116 0.19
117 0.15
118 0.14
119 0.11
120 0.08
121 0.08
122 0.08
123 0.08
124 0.07
125 0.07
126 0.07
127 0.06
128 0.06
129 0.05
130 0.05
131 0.05
132 0.05
133 0.05
134 0.05
135 0.06
136 0.06
137 0.06
138 0.05
139 0.05
140 0.08
141 0.15
142 0.18
143 0.22
144 0.22
145 0.24
146 0.27
147 0.28
148 0.3
149 0.32
150 0.38
151 0.43
152 0.45
153 0.5
154 0.48
155 0.53
156 0.49
157 0.41
158 0.35
159 0.29
160 0.33
161 0.27
162 0.26
163 0.22
164 0.21
165 0.23
166 0.21
167 0.17
168 0.12
169 0.18
170 0.19
171 0.2
172 0.21
173 0.19
174 0.22
175 0.22
176 0.22
177 0.16
178 0.15
179 0.14
180 0.11
181 0.09
182 0.06
183 0.05
184 0.05
185 0.04
186 0.02
187 0.02
188 0.02
189 0.02
190 0.02
191 0.02
192 0.02
193 0.02
194 0.02
195 0.02
196 0.03
197 0.04
198 0.04
199 0.04
200 0.04
201 0.05
202 0.06
203 0.07
204 0.07
205 0.07
206 0.08
207 0.09
208 0.09
209 0.09
210 0.07
211 0.06
212 0.06
213 0.05
214 0.06
215 0.05
216 0.05
217 0.07
218 0.09
219 0.09
220 0.1
221 0.1
222 0.1
223 0.12
224 0.13
225 0.1
226 0.1
227 0.1
228 0.09
229 0.09
230 0.09
231 0.07
232 0.06
233 0.07
234 0.05
235 0.05
236 0.05
237 0.06
238 0.07
239 0.08
240 0.09
241 0.09
242 0.14
243 0.15
244 0.15
245 0.15
246 0.16
247 0.16
248 0.17
249 0.18
250 0.16
251 0.18
252 0.21
253 0.21
254 0.2
255 0.18
256 0.16
257 0.14
258 0.11
259 0.1
260 0.08
261 0.06
262 0.09
263 0.09
264 0.11
265 0.13
266 0.17
267 0.2
268 0.25
269 0.27
270 0.29
271 0.33
272 0.33
273 0.34
274 0.32
275 0.28
276 0.22
277 0.21
278 0.16
279 0.11
280 0.1
281 0.07
282 0.06
283 0.08
284 0.13
285 0.14
286 0.16
287 0.19
288 0.22
289 0.28
290 0.33
291 0.35
292 0.34
293 0.35
294 0.34
295 0.3
296 0.27
297 0.23
298 0.18
299 0.14
300 0.12
301 0.12
302 0.12
303 0.12
304 0.13
305 0.12
306 0.12
307 0.15
308 0.15
309 0.18
310 0.22
311 0.25
312 0.27
313 0.34
314 0.35
315 0.34
316 0.34
317 0.31
318 0.27
319 0.33
320 0.34
321 0.33
322 0.4
323 0.46
324 0.52
325 0.54
326 0.6
327 0.63
328 0.68
329 0.73
330 0.76
331 0.76
332 0.78
333 0.84
334 0.84
335 0.84
336 0.85