Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1VLS1

Protein Details
Accession H1VLS1    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
62-81RTQSIKRRKLYTSRTRWRNRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 11.5, mito 5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005822  Ribosomal_L13  
IPR036899  Ribosomal_L13_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00572  Ribosomal_L13  
Amino Acid Sequences MSSFESVVVIDGKGHLLGRLASIVAKQLLNGQKIVVVRTEALNISGEFFRAKRMSIPIHNHRTQSIKRRKLYTSRTRWRNR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.08
4 0.08
5 0.08
6 0.08
7 0.08
8 0.07
9 0.08
10 0.09
11 0.1
12 0.09
13 0.08
14 0.14
15 0.19
16 0.19
17 0.19
18 0.17
19 0.18
20 0.19
21 0.19
22 0.14
23 0.1
24 0.09
25 0.09
26 0.1
27 0.08
28 0.08
29 0.08
30 0.08
31 0.09
32 0.08
33 0.08
34 0.08
35 0.08
36 0.12
37 0.11
38 0.12
39 0.13
40 0.18
41 0.22
42 0.29
43 0.38
44 0.44
45 0.52
46 0.55
47 0.54
48 0.52
49 0.54
50 0.54
51 0.56
52 0.58
53 0.59
54 0.62
55 0.67
56 0.71
57 0.74
58 0.77
59 0.77
60 0.78
61 0.79