Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H1VXK8

Protein Details
Accession H1VXK8    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
117-142KKSAEDEKLRAKRRRLEKQLNKKAKABasic
NLS Segment(s)
PositionSequence
65-106KPKETKPKTKKEAARKAHAKKMAEEAEDIERAKGMLSKKKRK
122-142DEKLRAKRRRLEKQLNKKAKA
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, pero 3
Family & Domain DBs
Amino Acid Sequences MDVDEADAGGMDVAGSEDDDEEEDGEGSDLDGVSADEEEANESEDDEEAQRQLELEAELTGGAVKPKETKPKTKKEAARKAHAKKMAEEAEDIERAKGMLSKKKRKLFEQMQYTNNKKSAEDEKLRAKRRRLEKQLNKKAKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.04
5 0.05
6 0.06
7 0.06
8 0.06
9 0.07
10 0.07
11 0.07
12 0.07
13 0.06
14 0.05
15 0.06
16 0.05
17 0.04
18 0.04
19 0.04
20 0.04
21 0.04
22 0.04
23 0.04
24 0.04
25 0.06
26 0.06
27 0.07
28 0.07
29 0.07
30 0.07
31 0.07
32 0.08
33 0.07
34 0.08
35 0.06
36 0.07
37 0.06
38 0.06
39 0.06
40 0.06
41 0.06
42 0.06
43 0.05
44 0.05
45 0.05
46 0.05
47 0.05
48 0.04
49 0.05
50 0.04
51 0.05
52 0.08
53 0.12
54 0.22
55 0.26
56 0.36
57 0.44
58 0.55
59 0.6
60 0.65
61 0.7
62 0.71
63 0.78
64 0.74
65 0.75
66 0.75
67 0.74
68 0.73
69 0.7
70 0.6
71 0.52
72 0.53
73 0.46
74 0.37
75 0.32
76 0.27
77 0.24
78 0.25
79 0.23
80 0.15
81 0.12
82 0.11
83 0.11
84 0.12
85 0.14
86 0.21
87 0.31
88 0.42
89 0.51
90 0.59
91 0.64
92 0.65
93 0.72
94 0.73
95 0.73
96 0.73
97 0.7
98 0.69
99 0.73
100 0.73
101 0.67
102 0.61
103 0.53
104 0.42
105 0.41
106 0.42
107 0.43
108 0.46
109 0.47
110 0.54
111 0.62
112 0.71
113 0.74
114 0.74
115 0.73
116 0.77
117 0.82
118 0.82
119 0.84
120 0.86
121 0.9
122 0.93