Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1VEZ8

Protein Details
Accession H1VEZ8    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
7-36SVDRERRPSPPPRRERERERERDRDRERDRBasic
NLS Segment(s)
PositionSequence
11-37ERRPSPPPRRERERERERDRDRERDRD
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MAESLLSVDRERRPSPPPRRERERERERDRDRERDRDYDRHRSRRDDDSHYDRERRDREEERERLYRRRMGSYDELPYGDERPSGSRRRREEDEDDRRDSRDSKVRRIPYTIIMPHPNHDANSRCRETPPPAAAPTTAAVKDKETTTVKDVAKEKEKEKEDPAGVHSGSEEGEIEED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.58
3 0.63
4 0.68
5 0.72
6 0.8
7 0.85
8 0.89
9 0.89
10 0.89
11 0.89
12 0.88
13 0.89
14 0.86
15 0.87
16 0.83
17 0.83
18 0.79
19 0.78
20 0.74
21 0.73
22 0.72
23 0.71
24 0.72
25 0.72
26 0.75
27 0.75
28 0.75
29 0.73
30 0.71
31 0.71
32 0.69
33 0.66
34 0.64
35 0.62
36 0.65
37 0.63
38 0.63
39 0.55
40 0.58
41 0.54
42 0.51
43 0.5
44 0.49
45 0.52
46 0.57
47 0.6
48 0.57
49 0.62
50 0.6
51 0.59
52 0.58
53 0.56
54 0.48
55 0.49
56 0.44
57 0.41
58 0.43
59 0.4
60 0.38
61 0.33
62 0.3
63 0.25
64 0.24
65 0.2
66 0.14
67 0.11
68 0.09
69 0.12
70 0.16
71 0.24
72 0.3
73 0.36
74 0.41
75 0.46
76 0.5
77 0.52
78 0.55
79 0.58
80 0.62
81 0.6
82 0.59
83 0.54
84 0.51
85 0.46
86 0.4
87 0.34
88 0.32
89 0.31
90 0.35
91 0.43
92 0.48
93 0.48
94 0.5
95 0.48
96 0.44
97 0.47
98 0.41
99 0.37
100 0.37
101 0.36
102 0.34
103 0.36
104 0.32
105 0.26
106 0.28
107 0.29
108 0.29
109 0.37
110 0.38
111 0.34
112 0.36
113 0.39
114 0.41
115 0.44
116 0.42
117 0.38
118 0.37
119 0.37
120 0.35
121 0.32
122 0.28
123 0.23
124 0.19
125 0.17
126 0.16
127 0.17
128 0.19
129 0.18
130 0.23
131 0.23
132 0.25
133 0.27
134 0.34
135 0.33
136 0.38
137 0.42
138 0.43
139 0.49
140 0.51
141 0.51
142 0.52
143 0.56
144 0.54
145 0.54
146 0.55
147 0.49
148 0.46
149 0.46
150 0.43
151 0.38
152 0.33
153 0.29
154 0.21
155 0.18
156 0.16
157 0.13