Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1V6B6

Protein Details
Accession H1V6B6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
361-383GSVLVYRPWRRRVEKRSEERAVLHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 17, extr 3, mito 2, E.R. 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR004688  Ni/Co_transpt  
IPR011541  Ni/Co_transpt_high_affinity  
Gene Ontology GO:0005886  C:plasma membrane  
GO:0015099  F:nickel cation transmembrane transporter activity  
KEGG chig:CH63R_03486  -  
Pfam View protein in Pfam  
PF03824  NicO  
Amino Acid Sequences MARFRVPFSSLPVPEPLRALPAPTVRIITLLIAVNVLIWAVAGVILHFHPALAPPAALSFVLGLRHALDADHISAIDLTTRRLIASGQRPVTVGTFFSLGHSTVVIITCVVVAATSGALRDRFDGFARVGNIVGTAVSAAFLLLLCAGNGWVLYKLIRRLRVVLDEERGSRKRGAAAQGHEMPAGEEQDEGNAAMDLKLEGEGFLASVFRKVFRVVDRPWKMFPLGILFGLGFDTSSEIAILGLSSVHGAQGTSIWLILIFPVLFTAGMCLLDTTDGALMMALYTSKAFSRDRVAILYYSIVLTGITVFVSAFIGAVQVLSLVANVAEPEGRFWDGVDAIGDHFDVIGGSICGLFVVVGLGSVLVYRPWRRRVEKRSEERAVLVPEEERGLGTGTGAGAGSSYGTVTAGGPTLKKGPVASEAAVQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.4
3 0.33
4 0.3
5 0.28
6 0.28
7 0.27
8 0.29
9 0.31
10 0.3
11 0.31
12 0.25
13 0.26
14 0.23
15 0.18
16 0.17
17 0.15
18 0.13
19 0.11
20 0.11
21 0.1
22 0.09
23 0.08
24 0.04
25 0.03
26 0.03
27 0.03
28 0.03
29 0.03
30 0.03
31 0.05
32 0.05
33 0.07
34 0.07
35 0.06
36 0.07
37 0.08
38 0.11
39 0.11
40 0.11
41 0.1
42 0.11
43 0.12
44 0.11
45 0.1
46 0.08
47 0.08
48 0.09
49 0.09
50 0.09
51 0.09
52 0.1
53 0.1
54 0.09
55 0.09
56 0.1
57 0.11
58 0.11
59 0.1
60 0.1
61 0.1
62 0.1
63 0.12
64 0.11
65 0.11
66 0.12
67 0.13
68 0.12
69 0.13
70 0.14
71 0.18
72 0.26
73 0.33
74 0.33
75 0.34
76 0.34
77 0.35
78 0.35
79 0.27
80 0.2
81 0.12
82 0.12
83 0.11
84 0.12
85 0.12
86 0.11
87 0.11
88 0.1
89 0.09
90 0.09
91 0.1
92 0.08
93 0.07
94 0.06
95 0.06
96 0.05
97 0.05
98 0.03
99 0.03
100 0.03
101 0.04
102 0.04
103 0.04
104 0.06
105 0.07
106 0.07
107 0.09
108 0.11
109 0.12
110 0.13
111 0.15
112 0.15
113 0.18
114 0.18
115 0.17
116 0.15
117 0.14
118 0.13
119 0.1
120 0.09
121 0.05
122 0.04
123 0.03
124 0.03
125 0.03
126 0.03
127 0.03
128 0.03
129 0.03
130 0.03
131 0.04
132 0.03
133 0.03
134 0.04
135 0.04
136 0.04
137 0.04
138 0.04
139 0.05
140 0.06
141 0.09
142 0.15
143 0.2
144 0.24
145 0.24
146 0.26
147 0.28
148 0.32
149 0.34
150 0.31
151 0.31
152 0.29
153 0.3
154 0.33
155 0.32
156 0.3
157 0.27
158 0.25
159 0.25
160 0.26
161 0.31
162 0.3
163 0.31
164 0.35
165 0.36
166 0.35
167 0.31
168 0.27
169 0.22
170 0.17
171 0.14
172 0.08
173 0.06
174 0.05
175 0.06
176 0.06
177 0.05
178 0.05
179 0.04
180 0.04
181 0.04
182 0.04
183 0.04
184 0.04
185 0.04
186 0.04
187 0.04
188 0.04
189 0.04
190 0.04
191 0.04
192 0.04
193 0.04
194 0.06
195 0.06
196 0.06
197 0.07
198 0.08
199 0.1
200 0.13
201 0.19
202 0.21
203 0.32
204 0.36
205 0.38
206 0.38
207 0.37
208 0.34
209 0.28
210 0.25
211 0.19
212 0.15
213 0.12
214 0.11
215 0.1
216 0.09
217 0.09
218 0.08
219 0.04
220 0.03
221 0.04
222 0.04
223 0.04
224 0.04
225 0.04
226 0.04
227 0.04
228 0.04
229 0.03
230 0.03
231 0.03
232 0.03
233 0.03
234 0.03
235 0.03
236 0.03
237 0.03
238 0.04
239 0.04
240 0.04
241 0.04
242 0.04
243 0.04
244 0.04
245 0.04
246 0.04
247 0.03
248 0.03
249 0.03
250 0.04
251 0.04
252 0.04
253 0.05
254 0.04
255 0.04
256 0.04
257 0.04
258 0.04
259 0.05
260 0.05
261 0.04
262 0.04
263 0.04
264 0.04
265 0.04
266 0.03
267 0.03
268 0.03
269 0.03
270 0.03
271 0.03
272 0.04
273 0.05
274 0.08
275 0.09
276 0.11
277 0.16
278 0.19
279 0.2
280 0.21
281 0.22
282 0.2
283 0.2
284 0.18
285 0.14
286 0.1
287 0.09
288 0.07
289 0.06
290 0.05
291 0.05
292 0.04
293 0.04
294 0.04
295 0.04
296 0.04
297 0.04
298 0.04
299 0.04
300 0.04
301 0.04
302 0.04
303 0.04
304 0.03
305 0.03
306 0.03
307 0.03
308 0.03
309 0.03
310 0.03
311 0.03
312 0.03
313 0.04
314 0.05
315 0.05
316 0.06
317 0.09
318 0.1
319 0.1
320 0.1
321 0.12
322 0.11
323 0.11
324 0.11
325 0.09
326 0.09
327 0.09
328 0.09
329 0.06
330 0.06
331 0.05
332 0.04
333 0.04
334 0.05
335 0.04
336 0.05
337 0.05
338 0.05
339 0.04
340 0.04
341 0.04
342 0.03
343 0.04
344 0.03
345 0.03
346 0.03
347 0.03
348 0.03
349 0.04
350 0.04
351 0.05
352 0.1
353 0.17
354 0.25
355 0.33
356 0.42
357 0.51
358 0.62
359 0.7
360 0.77
361 0.81
362 0.84
363 0.87
364 0.84
365 0.77
366 0.7
367 0.65
368 0.57
369 0.47
370 0.39
371 0.29
372 0.24
373 0.23
374 0.19
375 0.14
376 0.11
377 0.12
378 0.1
379 0.1
380 0.1
381 0.08
382 0.09
383 0.08
384 0.07
385 0.05
386 0.05
387 0.06
388 0.05
389 0.05
390 0.04
391 0.05
392 0.06
393 0.06
394 0.07
395 0.09
396 0.1
397 0.11
398 0.14
399 0.18
400 0.19
401 0.2
402 0.2
403 0.21
404 0.25
405 0.29
406 0.28