Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q8SVT6

Protein Details
Accession Q8SVT6    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
15-41EKDIERSYEPRRKPKRSRIQLHDWQSMHydrophilic
NLS Segment(s)
PositionSequence
25-30RRKPKR
Subcellular Location(s) nucl 22, cyto_nucl 13, mito 2, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR001356  Homeobox_dom  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
KEGG ecu:ECU04_0970  -  
Pfam View protein in Pfam  
PF00046  Homeodomain  
PROSITE View protein in PROSITE  
PS50071  HOMEOBOX_2  
CDD cd00086  homeodomain  
Amino Acid Sequences MTNGRKMEYKLVDSEKDIERSYEPRRKPKRSRIQLHDWQSMLLEHSFRMNPYPDRIEKYNLFLKTKIPMKNVKIWFQNRRAREKSFYEEAVEVHRDGRRAGHRSLGSRSALFAEEFQYRRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.39
3 0.37
4 0.35
5 0.3
6 0.27
7 0.31
8 0.38
9 0.42
10 0.45
11 0.53
12 0.63
13 0.71
14 0.79
15 0.84
16 0.86
17 0.88
18 0.91
19 0.88
20 0.88
21 0.87
22 0.84
23 0.78
24 0.67
25 0.56
26 0.46
27 0.38
28 0.29
29 0.21
30 0.13
31 0.08
32 0.1
33 0.1
34 0.1
35 0.12
36 0.13
37 0.14
38 0.17
39 0.23
40 0.22
41 0.26
42 0.28
43 0.3
44 0.28
45 0.31
46 0.33
47 0.31
48 0.3
49 0.26
50 0.26
51 0.27
52 0.32
53 0.32
54 0.3
55 0.34
56 0.36
57 0.45
58 0.47
59 0.47
60 0.49
61 0.53
62 0.57
63 0.59
64 0.63
65 0.59
66 0.65
67 0.64
68 0.61
69 0.59
70 0.57
71 0.54
72 0.51
73 0.47
74 0.4
75 0.36
76 0.32
77 0.3
78 0.27
79 0.2
80 0.19
81 0.19
82 0.17
83 0.17
84 0.23
85 0.27
86 0.3
87 0.32
88 0.37
89 0.39
90 0.43
91 0.48
92 0.46
93 0.41
94 0.37
95 0.36
96 0.3
97 0.27
98 0.24
99 0.19
100 0.18
101 0.22