Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H1VP61

Protein Details
Accession H1VP61    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-29VFPSRKPSRMSLKRLRPRQQTFRWPTKEHydrophilic
43-64GRSQADSHRPRPRCKQRRWTPEBasic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito_nucl 12.833, cyto_nucl 9.333, mito 8.5
Family & Domain DBs
Amino Acid Sequences MVFPSRKPSRMSLKRLRPRQQTFRWPTKEENVDRDPNRATVDGRSQADSHRPRPRCKQRRWTPE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.85
3 0.88
4 0.87
5 0.86
6 0.87
7 0.85
8 0.85
9 0.83
10 0.83
11 0.79
12 0.72
13 0.67
14 0.64
15 0.63
16 0.54
17 0.52
18 0.47
19 0.48
20 0.45
21 0.44
22 0.38
23 0.31
24 0.31
25 0.25
26 0.21
27 0.17
28 0.22
29 0.25
30 0.25
31 0.26
32 0.25
33 0.26
34 0.34
35 0.38
36 0.41
37 0.45
38 0.5
39 0.56
40 0.67
41 0.76
42 0.77
43 0.82
44 0.85