Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1VB73

Protein Details
Accession H1VB73    Localization Confidence Low Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
85-104EQPLKKTKSRDRESIKKKVMBasic
NLS Segment(s)
Subcellular Location(s) cyto 10.5, cyto_nucl 10, nucl 6.5, mito 3, E.R. 3, extr 1, pero 1, cysk 1, vacu 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG chig:CH63R_07238  -  
Amino Acid Sequences MALAVGIGIGMAIITTVIAIDGYVLYRKRQLKKKGDLEAPSGADLQPTDSSQPGEQSNGPQRKDPDVSHTSFQVEMAETSTQHGEQPLKKTKSRDRESIKKKVMDDAERKAEDKTQDERAWL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.02
2 0.02
3 0.02
4 0.02
5 0.02
6 0.02
7 0.03
8 0.03
9 0.04
10 0.08
11 0.09
12 0.11
13 0.18
14 0.26
15 0.35
16 0.44
17 0.54
18 0.6
19 0.7
20 0.77
21 0.79
22 0.78
23 0.72
24 0.67
25 0.61
26 0.51
27 0.42
28 0.34
29 0.25
30 0.18
31 0.15
32 0.12
33 0.09
34 0.09
35 0.09
36 0.09
37 0.1
38 0.1
39 0.12
40 0.11
41 0.12
42 0.12
43 0.16
44 0.24
45 0.28
46 0.29
47 0.29
48 0.31
49 0.33
50 0.35
51 0.31
52 0.3
53 0.29
54 0.31
55 0.29
56 0.28
57 0.25
58 0.22
59 0.22
60 0.15
61 0.1
62 0.08
63 0.09
64 0.09
65 0.08
66 0.09
67 0.1
68 0.09
69 0.09
70 0.12
71 0.14
72 0.18
73 0.26
74 0.35
75 0.39
76 0.43
77 0.5
78 0.57
79 0.64
80 0.66
81 0.68
82 0.67
83 0.74
84 0.78
85 0.81
86 0.8
87 0.74
88 0.69
89 0.67
90 0.65
91 0.64
92 0.62
93 0.59
94 0.6
95 0.57
96 0.57
97 0.5
98 0.47
99 0.43
100 0.42
101 0.39
102 0.39