Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5B0NU74

Protein Details
Accession A0A5B0NU74    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
110-135LLKAVPKKKVSHSRKRMRSAHKGIQPHydrophilic
NLS Segment(s)
PositionSequence
115-130PKKKVSHSRKRMRSAH
Subcellular Location(s) mito 16, nucl 10.5, cyto_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences MASIILSTTRNPIRSTGKQQLIPLLNQLRAVTIDDGRLIGLPTTTTDFSSISRVFQSIKQNLCQSFAEISSSILHPHQSSSASSSSSSSAAAAATATTIDPYFFYDFGGLLKAVPKKKVSHSRKRMRSAHKGIQPNLSLGVCPACGEPKRQHFLCLHCYADKVLERSKSIKTPWEKGITP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.52
3 0.55
4 0.57
5 0.58
6 0.59
7 0.62
8 0.56
9 0.49
10 0.48
11 0.42
12 0.36
13 0.34
14 0.32
15 0.24
16 0.22
17 0.23
18 0.18
19 0.14
20 0.14
21 0.13
22 0.13
23 0.12
24 0.12
25 0.1
26 0.07
27 0.07
28 0.06
29 0.07
30 0.1
31 0.11
32 0.11
33 0.11
34 0.12
35 0.13
36 0.18
37 0.17
38 0.15
39 0.15
40 0.16
41 0.16
42 0.21
43 0.28
44 0.29
45 0.31
46 0.34
47 0.37
48 0.37
49 0.39
50 0.34
51 0.27
52 0.22
53 0.2
54 0.18
55 0.13
56 0.14
57 0.12
58 0.11
59 0.11
60 0.1
61 0.1
62 0.09
63 0.09
64 0.1
65 0.1
66 0.1
67 0.12
68 0.12
69 0.12
70 0.12
71 0.12
72 0.12
73 0.11
74 0.11
75 0.08
76 0.07
77 0.06
78 0.06
79 0.05
80 0.03
81 0.03
82 0.03
83 0.03
84 0.03
85 0.03
86 0.03
87 0.04
88 0.06
89 0.07
90 0.07
91 0.08
92 0.08
93 0.08
94 0.08
95 0.09
96 0.06
97 0.06
98 0.1
99 0.14
100 0.17
101 0.2
102 0.23
103 0.25
104 0.34
105 0.45
106 0.51
107 0.57
108 0.66
109 0.74
110 0.8
111 0.87
112 0.87
113 0.85
114 0.86
115 0.84
116 0.82
117 0.79
118 0.77
119 0.7
120 0.68
121 0.6
122 0.5
123 0.43
124 0.34
125 0.26
126 0.19
127 0.17
128 0.11
129 0.1
130 0.1
131 0.13
132 0.15
133 0.2
134 0.28
135 0.35
136 0.43
137 0.43
138 0.48
139 0.47
140 0.51
141 0.54
142 0.51
143 0.46
144 0.39
145 0.4
146 0.36
147 0.37
148 0.36
149 0.31
150 0.32
151 0.33
152 0.35
153 0.38
154 0.42
155 0.42
156 0.42
157 0.47
158 0.48
159 0.51
160 0.56