Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B0PHW3

Protein Details
Accession A0A5B0PHW3    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
28-49DNNSNQLSKKQLKRQLKRQLILHydrophilic
NLS Segment(s)
PositionSequence
40-69KRQLKRQLILDERPAKRAAERARKKAKKLE
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR028564  MT_TRM10-typ  
IPR038459  MT_TRM10-typ_sf  
IPR007356  tRNA_m1G_MeTrfase_euk  
Gene Ontology GO:0008168  F:methyltransferase activity  
GO:0032259  P:methylation  
GO:0008033  P:tRNA processing  
PROSITE View protein in PROSITE  
PS51675  SAM_MT_TRM10  
Amino Acid Sequences MNSPTSSSQEIEEPLKGTSTTRIKQEEDNNSNQLSKKQLKRQLKRQLILDERPAKRAAERARKKAKKLESKNSTTPKQQEDGGNSNKQKPIIFPATVVFDCRFDDKMSDKNLCLDLATNQAFQHAQLPIAEHFSQLKTRKVLTVNQVFEILVNYLVDQDWKNAFERVIPSRKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.19
4 0.17
5 0.22
6 0.28
7 0.29
8 0.35
9 0.39
10 0.4
11 0.47
12 0.55
13 0.57
14 0.54
15 0.56
16 0.53
17 0.5
18 0.5
19 0.44
20 0.38
21 0.36
22 0.39
23 0.42
24 0.48
25 0.57
26 0.65
27 0.73
28 0.81
29 0.84
30 0.84
31 0.8
32 0.76
33 0.76
34 0.71
35 0.66
36 0.64
37 0.63
38 0.54
39 0.53
40 0.48
41 0.39
42 0.34
43 0.37
44 0.38
45 0.39
46 0.46
47 0.54
48 0.64
49 0.69
50 0.73
51 0.74
52 0.74
53 0.74
54 0.75
55 0.76
56 0.73
57 0.74
58 0.78
59 0.76
60 0.7
61 0.64
62 0.6
63 0.52
64 0.44
65 0.41
66 0.35
67 0.33
68 0.36
69 0.35
70 0.37
71 0.35
72 0.37
73 0.35
74 0.33
75 0.29
76 0.23
77 0.24
78 0.23
79 0.21
80 0.19
81 0.19
82 0.21
83 0.21
84 0.22
85 0.16
86 0.13
87 0.13
88 0.14
89 0.14
90 0.11
91 0.13
92 0.14
93 0.19
94 0.22
95 0.23
96 0.22
97 0.23
98 0.24
99 0.22
100 0.19
101 0.15
102 0.12
103 0.16
104 0.17
105 0.15
106 0.14
107 0.15
108 0.15
109 0.15
110 0.17
111 0.12
112 0.11
113 0.11
114 0.13
115 0.12
116 0.18
117 0.17
118 0.14
119 0.16
120 0.17
121 0.24
122 0.25
123 0.3
124 0.28
125 0.29
126 0.33
127 0.35
128 0.39
129 0.41
130 0.47
131 0.44
132 0.42
133 0.41
134 0.36
135 0.33
136 0.29
137 0.2
138 0.11
139 0.09
140 0.08
141 0.08
142 0.08
143 0.1
144 0.1
145 0.13
146 0.14
147 0.16
148 0.18
149 0.19
150 0.19
151 0.21
152 0.27
153 0.32