Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5B0NJY9

Protein Details
Accession A0A5B0NJY9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
27-47QSLKHCVNSHQKKKTPTRTGYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, cyto_nucl 9.5, mito 6, cyto 5.5, pero 3
Family & Domain DBs
Amino Acid Sequences MSSPRPTRAHPELPEGPVPENVGDPHQSLKHCVNSHQKKKTPTRTGYEVTTGTKWTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.46
3 0.4
4 0.32
5 0.3
6 0.22
7 0.18
8 0.15
9 0.13
10 0.13
11 0.12
12 0.13
13 0.14
14 0.14
15 0.16
16 0.19
17 0.23
18 0.23
19 0.29
20 0.38
21 0.46
22 0.55
23 0.62
24 0.64
25 0.68
26 0.77
27 0.82
28 0.81
29 0.77
30 0.75
31 0.72
32 0.7
33 0.64
34 0.58
35 0.5
36 0.44
37 0.39