Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5B0Q5K4

Protein Details
Accession A0A5B0Q5K4    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
51-70VICYHYTCQRRRQPPPGHGHHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 14, mito 7, cyto_nucl 4, nucl 3, cyto 3
Family & Domain DBs
Amino Acid Sequences MHFYLSIIVSLLIFQGVLSVPLPSELSSDYGDVKLGNGPGEGSKNPQIPPVICYHYTCQRRRQPPPGHGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.05
5 0.05
6 0.05
7 0.05
8 0.06
9 0.07
10 0.06
11 0.07
12 0.07
13 0.09
14 0.09
15 0.1
16 0.1
17 0.1
18 0.1
19 0.09
20 0.08
21 0.07
22 0.07
23 0.07
24 0.06
25 0.06
26 0.07
27 0.09
28 0.09
29 0.12
30 0.16
31 0.19
32 0.19
33 0.22
34 0.24
35 0.22
36 0.24
37 0.26
38 0.26
39 0.25
40 0.27
41 0.29
42 0.36
43 0.45
44 0.47
45 0.52
46 0.58
47 0.67
48 0.73
49 0.79
50 0.79