Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5B0NKD8

Protein Details
Accession A0A5B0NKD8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
63-83LKCCTAKTIKHPKSTKDCKLPHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 24, golg 3
Family & Domain DBs
Amino Acid Sequences MKSITSIVACVFSALGFFIGHATSLTPSDGPSCPSDHPLLLCDGGIDGVVEPVEGKCPGETKLKCCTAKTIKHPKSTKDCKLP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.05
4 0.05
5 0.06
6 0.06
7 0.06
8 0.06
9 0.06
10 0.06
11 0.07
12 0.08
13 0.07
14 0.07
15 0.1
16 0.1
17 0.12
18 0.12
19 0.14
20 0.14
21 0.17
22 0.18
23 0.15
24 0.15
25 0.14
26 0.14
27 0.11
28 0.1
29 0.07
30 0.06
31 0.06
32 0.05
33 0.04
34 0.03
35 0.03
36 0.03
37 0.03
38 0.03
39 0.03
40 0.05
41 0.05
42 0.06
43 0.06
44 0.08
45 0.11
46 0.2
47 0.22
48 0.25
49 0.33
50 0.41
51 0.43
52 0.43
53 0.5
54 0.5
55 0.57
56 0.64
57 0.67
58 0.66
59 0.74
60 0.79
61 0.78
62 0.8
63 0.82