Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B0N0X1

Protein Details
Accession A0A5B0N0X1   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
77-102QETRTYQNPRCPRRHNIARCNINHDDHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 2, extr 21, mito 3
Family & Domain DBs
Amino Acid Sequences MLRVQLLSVLLLCSSFHLGRAPGANSNYSALCRHTEQRCHGAIVQCDVTVRCNRGGDHGICGTGRDASIKICTMCGQETRTYQNPRCPRRHNIARCNINHDDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.12
4 0.13
5 0.14
6 0.16
7 0.19
8 0.19
9 0.2
10 0.21
11 0.21
12 0.2
13 0.21
14 0.2
15 0.18
16 0.17
17 0.14
18 0.15
19 0.17
20 0.23
21 0.27
22 0.33
23 0.36
24 0.41
25 0.4
26 0.39
27 0.4
28 0.37
29 0.32
30 0.28
31 0.24
32 0.18
33 0.18
34 0.16
35 0.15
36 0.14
37 0.14
38 0.13
39 0.14
40 0.14
41 0.17
42 0.21
43 0.19
44 0.19
45 0.18
46 0.17
47 0.16
48 0.16
49 0.13
50 0.1
51 0.09
52 0.07
53 0.07
54 0.08
55 0.1
56 0.11
57 0.11
58 0.11
59 0.12
60 0.13
61 0.14
62 0.16
63 0.17
64 0.2
65 0.23
66 0.29
67 0.35
68 0.42
69 0.45
70 0.52
71 0.59
72 0.64
73 0.71
74 0.71
75 0.71
76 0.74
77 0.8
78 0.81
79 0.82
80 0.83
81 0.84
82 0.8
83 0.8