Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B0R3Y8

Protein Details
Accession A0A5B0R3Y8    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
25-50YVSNCKPQHPHSKKPKHGDLNPRCFCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto 6, pero 2
Family & Domain DBs
Amino Acid Sequences MVIQATKTLDVNLDPSVQDIEGFAYVSNCKPQHPHSKKPKHGDLNPRCFC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.12
4 0.11
5 0.1
6 0.08
7 0.07
8 0.06
9 0.07
10 0.06
11 0.06
12 0.06
13 0.07
14 0.12
15 0.12
16 0.12
17 0.15
18 0.22
19 0.33
20 0.4
21 0.5
22 0.56
23 0.67
24 0.76
25 0.82
26 0.85
27 0.84
28 0.85
29 0.86
30 0.86