Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B0Q7Z4

Protein Details
Accession A0A5B0Q7Z4    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
5-34REKKGQLTANQPKPKNKRHTQKNNIHPSTIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MTVKREKKGQLTANQPKPKNKRHTQKNNIHPSTIDNRQSRTEQPIGACTIDSDSHRPPSRFLSSIYSPFIPRCIRLAAASCLKSIVSLPRSERA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.77
3 0.78
4 0.79
5 0.81
6 0.8
7 0.8
8 0.8
9 0.83
10 0.89
11 0.9
12 0.91
13 0.91
14 0.92
15 0.83
16 0.73
17 0.62
18 0.56
19 0.51
20 0.48
21 0.45
22 0.36
23 0.36
24 0.38
25 0.41
26 0.38
27 0.37
28 0.32
29 0.26
30 0.25
31 0.24
32 0.23
33 0.2
34 0.18
35 0.12
36 0.11
37 0.1
38 0.11
39 0.12
40 0.13
41 0.2
42 0.24
43 0.25
44 0.25
45 0.3
46 0.33
47 0.31
48 0.31
49 0.31
50 0.3
51 0.33
52 0.34
53 0.3
54 0.26
55 0.25
56 0.29
57 0.24
58 0.21
59 0.21
60 0.21
61 0.2
62 0.22
63 0.25
64 0.26
65 0.32
66 0.31
67 0.29
68 0.27
69 0.25
70 0.24
71 0.22
72 0.24
73 0.21
74 0.25