FuNGI

A0A5B0PLG5

Protein Details

Accession

A0A5B0PLG5

Localization Confidence

Medium

Confidence Score

13.5

NoLS Segment(s)

Position	Sequence	Protein Nature
363-384	VDPSPAKKAKKVKKGKGAMLGP	Hydrophilic

NLS Segment(s)

Position	Sequence
368-379	AKKAKKVKKGKG

Subcellular Location(s)

nucl 22.5, cyto_nucl 14, cyto 4.5

Family & Domain DBs

InterPro	View protein in InterPro IPR013893 RNase_P_Rpp40
Gene Ontology	GO:0030677 C:ribonuclease P complex GO:0001682 P:tRNA 5'-leader removal
Pfam	View protein in Pfam PF08584 Ribonuc_P_40

Amino Acid Sequences

MVAAKHHTKVKQVEMSHHKKPIKATVPKAHLYISDGYLSSDNSIPIPTKDEPARPPSRQILHHPFTSQINLILSNAEKPESIDGSEPTRCPEILKHLSDLGKYQHFSNLNLADLLLDEFVQTYFRSGSLVAISLPKFTGDDLFAIDGYGTIHMRLSQSTYQTLGLSGRRSKYGSPGQHFVVEIDMRDRAMRSGKALYERTKRCLDKFPGDVFNDLLGPKHETRGRRWDVVMAWVDEQGSLQPINSSLLSPTTTCKTCVPEINCLEKLVPHITKPDTVESYLDLYEQIGEALLSTSDNHPHPKGGITANSIEAVGFFHPTKLAELTEKVLKIYRIVSITGHTARSAPFSFLTLKQTNRTTHQPVDPSPAKKAKKVKKGKGAMLGPERAVDAGPSSWTFVALEEAEEAPACSSDPSSVPDPSPSALAVLASPQISLDASTDLVVRKRHRPDNDPSSDLTGIPKRPWIIFESVGALDTHC

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.64
2	0.69
3	0.69
4	0.71
5	0.66
6	0.61
7	0.64
8	0.64
9	0.64
10	0.66
11	0.68
12	0.69
13	0.72
14	0.71
15	0.67
16	0.58
17	0.49
18	0.44
19	0.37
20	0.29
21	0.25
22	0.22
23	0.22
24	0.21
25	0.2
26	0.19
27	0.17
28	0.15
29	0.13
30	0.15
31	0.15
32	0.15
33	0.2
34	0.19
35	0.25
36	0.29
37	0.34
38	0.38
39	0.46
40	0.54
41	0.5
42	0.56
43	0.58
44	0.59
45	0.58
46	0.62
47	0.63
48	0.59
49	0.6
50	0.54
51	0.49
52	0.45
53	0.43
54	0.34
55	0.26
56	0.23
57	0.2
58	0.19
59	0.18
60	0.16
61	0.16
62	0.16
63	0.14
64	0.13
65	0.13
66	0.17
67	0.16
68	0.16
69	0.16
70	0.17
71	0.2
72	0.24
73	0.23
74	0.22
75	0.23
76	0.22
77	0.22
78	0.23
79	0.28
80	0.33
81	0.35
82	0.34
83	0.37
84	0.39
85	0.38
86	0.37
87	0.33
88	0.3
89	0.28
90	0.27
91	0.29
92	0.29
93	0.3
94	0.33
95	0.3
96	0.25
97	0.24
98	0.23
99	0.16
100	0.15
101	0.14
102	0.07
103	0.06
104	0.05
105	0.05
106	0.05
107	0.06
108	0.06
109	0.07
110	0.07
111	0.07
112	0.08
113	0.08
114	0.09
115	0.09
116	0.09
117	0.08
118	0.12
119	0.12
120	0.12
121	0.12
122	0.11
123	0.11
124	0.11
125	0.12
126	0.08
127	0.09
128	0.09
129	0.09
130	0.09
131	0.09
132	0.08
133	0.07
134	0.06
135	0.07
136	0.06
137	0.06
138	0.06
139	0.07
140	0.08
141	0.08
142	0.12
143	0.14
144	0.15
145	0.16
146	0.18
147	0.17
148	0.17
149	0.17
150	0.15
151	0.15
152	0.18
153	0.21
154	0.21
155	0.22
156	0.24
157	0.24
158	0.29
159	0.35
160	0.39
161	0.39
162	0.41
163	0.4
164	0.4
165	0.39
166	0.32
167	0.26
168	0.18
169	0.14
170	0.12
171	0.11
172	0.1
173	0.1
174	0.1
175	0.09
176	0.12
177	0.12
178	0.13
179	0.16
180	0.18
181	0.23
182	0.27
183	0.32
184	0.38
185	0.4
186	0.42
187	0.47
188	0.48
189	0.45
190	0.51
191	0.49
192	0.46
193	0.48
194	0.47
195	0.46
196	0.44
197	0.41
198	0.33
199	0.27
200	0.22
201	0.17
202	0.13
203	0.09
204	0.12
205	0.11
206	0.15
207	0.18
208	0.19
209	0.24
210	0.34
211	0.37
212	0.35
213	0.35
214	0.34
215	0.32
216	0.34
217	0.31
218	0.21
219	0.18
220	0.16
221	0.15
222	0.12
223	0.11
224	0.07
225	0.06
226	0.05
227	0.04
228	0.04
229	0.05
230	0.06
231	0.06
232	0.06
233	0.06
234	0.07
235	0.07
236	0.08
237	0.09
238	0.11
239	0.12
240	0.13
241	0.15
242	0.17
243	0.19
244	0.25
245	0.26
246	0.31
247	0.34
248	0.38
249	0.36
250	0.34
251	0.31
252	0.25
253	0.26
254	0.22
255	0.19
256	0.14
257	0.18
258	0.19
259	0.21
260	0.22
261	0.23
262	0.19
263	0.19
264	0.19
265	0.16
266	0.17
267	0.14
268	0.13
269	0.09
270	0.08
271	0.07
272	0.07
273	0.05
274	0.04
275	0.03
276	0.03
277	0.03
278	0.03
279	0.03
280	0.05
281	0.06
282	0.09
283	0.11
284	0.14
285	0.14
286	0.15
287	0.16
288	0.16
289	0.18
290	0.17
291	0.18
292	0.18
293	0.19
294	0.19
295	0.18
296	0.17
297	0.13
298	0.11
299	0.09
300	0.07
301	0.08
302	0.07
303	0.07
304	0.08
305	0.09
306	0.1
307	0.1
308	0.11
309	0.11
310	0.12
311	0.15
312	0.18
313	0.18
314	0.17
315	0.19
316	0.18
317	0.17
318	0.17
319	0.18
320	0.15
321	0.16
322	0.16
323	0.15
324	0.2
325	0.2
326	0.19
327	0.16
328	0.16
329	0.16
330	0.19
331	0.19
332	0.16
333	0.14
334	0.16
335	0.19
336	0.2
337	0.27
338	0.27
339	0.28
340	0.32
341	0.37
342	0.38
343	0.4
344	0.45
345	0.44
346	0.45
347	0.48
348	0.47
349	0.44
350	0.5
351	0.52
352	0.47
353	0.48
354	0.52
355	0.49
356	0.52
357	0.6
358	0.61
359	0.65
360	0.73
361	0.76
362	0.77
363	0.83
364	0.83
365	0.82
366	0.76
367	0.73
368	0.69
369	0.62
370	0.51
371	0.43
372	0.37
373	0.28
374	0.23
375	0.15
376	0.1
377	0.08
378	0.1
379	0.1
380	0.11
381	0.11
382	0.12
383	0.11
384	0.1
385	0.12
386	0.11
387	0.11
388	0.11
389	0.11
390	0.11
391	0.11
392	0.1
393	0.08
394	0.08
395	0.08
396	0.06
397	0.07
398	0.08
399	0.1
400	0.14
401	0.17
402	0.19
403	0.19
404	0.21
405	0.23
406	0.22
407	0.22
408	0.18
409	0.15
410	0.13
411	0.12
412	0.1
413	0.09
414	0.11
415	0.09
416	0.09
417	0.08
418	0.09
419	0.09
420	0.09
421	0.09
422	0.08
423	0.08
424	0.09
425	0.11
426	0.13
427	0.17
428	0.24
429	0.28
430	0.35
431	0.44
432	0.53
433	0.59
434	0.64
435	0.7
436	0.74
437	0.77
438	0.71
439	0.64
440	0.61
441	0.54
442	0.47
443	0.43
444	0.39
445	0.35
446	0.34
447	0.37
448	0.34
449	0.34
450	0.36
451	0.35
452	0.34
453	0.32
454	0.32
455	0.31
456	0.28
457	0.28

A0A5B0PLG5

3D AlphaFold-predicted Structure Viewer