Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B0MC46

Protein Details
Accession A0A5B0MC46    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
12-46RDPFANKRPSARKNIGANRRPPHPSNPNQNSSRKQHydrophilic
NLS Segment(s)
PositionSequence
19-33RPSARKNIGANRRPP
Subcellular Location(s) nucl 18, cyto_nucl 12.5, cyto 5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013226  Pal1  
Pfam View protein in Pfam  
PF08316  Pal1  
Amino Acid Sequences MSTTTTNLQESRDPFANKRPSARKNIGANRRPPHPSNPNQNSSRKQTKAPVSGGSNPKKSSSHGALDFIDTLDTIGGFHHDGPFDAASSHRNRHMNSKNPSRQAPMAAFDPSALILPPPPPASAPAPVSLASQDHVYPPAIPRRASDNTMPVSMGYPAGTIAADPKAARLAEAFGIQGKEAWEDFGMEHAIEEGSTGGGGLLGHRRGTSREQRDAKSASVWDMEETLKSGKPVPSAYTPRSEASARGANGELERQATNAAQLKRSKSLMQRIKKGVKSPNLPMEMPPSPISGDPNEYEELRSDPPSTSQLPPSSPIGRKASLLHKFGLVKRSNTRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.48
3 0.55
4 0.53
5 0.61
6 0.64
7 0.65
8 0.71
9 0.75
10 0.74
11 0.75
12 0.81
13 0.82
14 0.8
15 0.82
16 0.77
17 0.76
18 0.75
19 0.68
20 0.68
21 0.68
22 0.69
23 0.71
24 0.74
25 0.76
26 0.76
27 0.8
28 0.77
29 0.76
30 0.77
31 0.68
32 0.65
33 0.65
34 0.67
35 0.67
36 0.63
37 0.6
38 0.55
39 0.6
40 0.65
41 0.63
42 0.6
43 0.53
44 0.53
45 0.48
46 0.46
47 0.46
48 0.42
49 0.41
50 0.38
51 0.39
52 0.37
53 0.37
54 0.34
55 0.26
56 0.2
57 0.13
58 0.11
59 0.07
60 0.06
61 0.05
62 0.04
63 0.06
64 0.06
65 0.07
66 0.09
67 0.09
68 0.09
69 0.12
70 0.12
71 0.11
72 0.1
73 0.11
74 0.14
75 0.19
76 0.21
77 0.25
78 0.29
79 0.3
80 0.4
81 0.48
82 0.53
83 0.57
84 0.65
85 0.67
86 0.68
87 0.7
88 0.64
89 0.57
90 0.52
91 0.45
92 0.36
93 0.3
94 0.26
95 0.23
96 0.18
97 0.16
98 0.12
99 0.1
100 0.08
101 0.06
102 0.06
103 0.06
104 0.09
105 0.09
106 0.09
107 0.1
108 0.12
109 0.15
110 0.17
111 0.18
112 0.17
113 0.17
114 0.17
115 0.17
116 0.15
117 0.13
118 0.1
119 0.09
120 0.09
121 0.08
122 0.09
123 0.09
124 0.09
125 0.12
126 0.18
127 0.2
128 0.2
129 0.2
130 0.26
131 0.29
132 0.3
133 0.29
134 0.27
135 0.27
136 0.27
137 0.26
138 0.19
139 0.17
140 0.14
141 0.12
142 0.07
143 0.05
144 0.05
145 0.05
146 0.05
147 0.04
148 0.05
149 0.05
150 0.06
151 0.05
152 0.06
153 0.07
154 0.07
155 0.08
156 0.07
157 0.07
158 0.07
159 0.08
160 0.08
161 0.07
162 0.07
163 0.07
164 0.08
165 0.07
166 0.07
167 0.07
168 0.07
169 0.06
170 0.06
171 0.06
172 0.07
173 0.07
174 0.06
175 0.06
176 0.05
177 0.05
178 0.04
179 0.04
180 0.03
181 0.03
182 0.03
183 0.03
184 0.02
185 0.03
186 0.03
187 0.04
188 0.07
189 0.08
190 0.08
191 0.09
192 0.09
193 0.12
194 0.19
195 0.28
196 0.32
197 0.41
198 0.47
199 0.48
200 0.53
201 0.52
202 0.46
203 0.39
204 0.33
205 0.25
206 0.21
207 0.2
208 0.15
209 0.14
210 0.13
211 0.11
212 0.11
213 0.12
214 0.11
215 0.11
216 0.14
217 0.15
218 0.17
219 0.18
220 0.2
221 0.27
222 0.32
223 0.34
224 0.35
225 0.36
226 0.34
227 0.36
228 0.33
229 0.26
230 0.25
231 0.29
232 0.24
233 0.23
234 0.23
235 0.21
236 0.21
237 0.22
238 0.17
239 0.13
240 0.13
241 0.11
242 0.12
243 0.11
244 0.15
245 0.2
246 0.21
247 0.25
248 0.29
249 0.32
250 0.36
251 0.38
252 0.4
253 0.4
254 0.49
255 0.54
256 0.58
257 0.63
258 0.69
259 0.75
260 0.74
261 0.74
262 0.72
263 0.71
264 0.69
265 0.67
266 0.67
267 0.62
268 0.58
269 0.52
270 0.5
271 0.43
272 0.4
273 0.33
274 0.26
275 0.23
276 0.23
277 0.25
278 0.2
279 0.23
280 0.2
281 0.23
282 0.23
283 0.23
284 0.23
285 0.21
286 0.22
287 0.21
288 0.22
289 0.2
290 0.19
291 0.21
292 0.25
293 0.28
294 0.28
295 0.31
296 0.33
297 0.34
298 0.36
299 0.39
300 0.42
301 0.42
302 0.45
303 0.45
304 0.43
305 0.43
306 0.45
307 0.49
308 0.49
309 0.49
310 0.43
311 0.43
312 0.47
313 0.5
314 0.54
315 0.49
316 0.48