Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B0MJS9

Protein Details
Accession A0A5B0MJS9   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
63-82VLWLRKKAKKLKFFRFNKLGHydrophilic
NLS Segment(s)
PositionSequence
68-72KKAKK
Subcellular Location(s) E.R. 6, mito 8, plas 11
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MADPAQEIFQFILNLPQSVNPYEAVAVQIKELTQVPKPPLWGRIVRRVLAFQFFILCVQCITVLWLRKKAKKLKFFRFNKLGLIHIEVLNEIVFFMLLFSIHVLLDQSRPLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.18
4 0.18
5 0.19
6 0.2
7 0.14
8 0.14
9 0.14
10 0.14
11 0.13
12 0.13
13 0.12
14 0.11
15 0.11
16 0.1
17 0.11
18 0.13
19 0.13
20 0.13
21 0.17
22 0.2
23 0.21
24 0.24
25 0.25
26 0.27
27 0.29
28 0.33
29 0.33
30 0.41
31 0.42
32 0.4
33 0.39
34 0.37
35 0.34
36 0.3
37 0.26
38 0.15
39 0.13
40 0.11
41 0.11
42 0.09
43 0.08
44 0.05
45 0.05
46 0.05
47 0.04
48 0.06
49 0.09
50 0.14
51 0.16
52 0.25
53 0.3
54 0.35
55 0.43
56 0.51
57 0.56
58 0.61
59 0.69
60 0.72
61 0.78
62 0.79
63 0.81
64 0.78
65 0.71
66 0.66
67 0.58
68 0.49
69 0.4
70 0.38
71 0.3
72 0.24
73 0.22
74 0.17
75 0.15
76 0.13
77 0.11
78 0.07
79 0.05
80 0.04
81 0.04
82 0.04
83 0.03
84 0.03
85 0.04
86 0.05
87 0.05
88 0.05
89 0.06
90 0.07
91 0.08
92 0.1