Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B0LS70

Protein Details
Accession A0A5B0LS70    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
222-249MMAKSRGNENKKLPRNKMKERRRFLSAMHydrophilic
NLS Segment(s)
PositionSequence
214-244NKRPERFAMMAKSRGNENKKLPRNKMKERRR
Subcellular Location(s) mito 14.5, mito_nucl 13, nucl 10.5
Family & Domain DBs
Amino Acid Sequences MKKLLQSTLIILPQFHFIVSHLNHNVPFDEEKVFVPLQEYSFLSGLPEEIQDRSYDPPTRQLLPSHQSFRDPQTEELGMRHRMIQSDLMPPTLSLHIGSPPPGESNLPAVGGDPRGKKRLSSVGPSQEIEVQGKTRQSASQDTAYLPASKKPNLILSLGLPGYENVQETAEFSSGLASEHDAARAEKNRLPQVDNVLDARINETKPIVLASKANKRPERFAMMAKSRGNENKKLPRNKMKERRRFLSAMEGAIAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.2
3 0.14
4 0.12
5 0.19
6 0.2
7 0.27
8 0.26
9 0.29
10 0.29
11 0.3
12 0.31
13 0.26
14 0.26
15 0.2
16 0.2
17 0.18
18 0.18
19 0.21
20 0.2
21 0.17
22 0.17
23 0.17
24 0.16
25 0.17
26 0.17
27 0.16
28 0.16
29 0.16
30 0.14
31 0.12
32 0.12
33 0.1
34 0.1
35 0.09
36 0.09
37 0.1
38 0.1
39 0.12
40 0.15
41 0.19
42 0.22
43 0.22
44 0.29
45 0.33
46 0.35
47 0.36
48 0.36
49 0.38
50 0.38
51 0.44
52 0.41
53 0.39
54 0.39
55 0.39
56 0.4
57 0.41
58 0.38
59 0.33
60 0.32
61 0.33
62 0.3
63 0.3
64 0.3
65 0.25
66 0.22
67 0.23
68 0.2
69 0.19
70 0.2
71 0.21
72 0.18
73 0.22
74 0.22
75 0.2
76 0.19
77 0.18
78 0.19
79 0.16
80 0.14
81 0.08
82 0.08
83 0.1
84 0.1
85 0.11
86 0.1
87 0.1
88 0.1
89 0.1
90 0.1
91 0.09
92 0.11
93 0.11
94 0.1
95 0.09
96 0.09
97 0.09
98 0.11
99 0.14
100 0.15
101 0.18
102 0.21
103 0.21
104 0.21
105 0.23
106 0.3
107 0.3
108 0.31
109 0.34
110 0.37
111 0.39
112 0.39
113 0.36
114 0.29
115 0.27
116 0.22
117 0.17
118 0.12
119 0.12
120 0.12
121 0.12
122 0.11
123 0.12
124 0.13
125 0.17
126 0.18
127 0.19
128 0.19
129 0.19
130 0.2
131 0.2
132 0.19
133 0.16
134 0.18
135 0.19
136 0.19
137 0.2
138 0.19
139 0.23
140 0.22
141 0.22
142 0.18
143 0.16
144 0.18
145 0.17
146 0.15
147 0.11
148 0.1
149 0.1
150 0.1
151 0.1
152 0.07
153 0.07
154 0.07
155 0.08
156 0.1
157 0.08
158 0.08
159 0.07
160 0.07
161 0.07
162 0.07
163 0.07
164 0.06
165 0.07
166 0.07
167 0.08
168 0.09
169 0.1
170 0.14
171 0.19
172 0.21
173 0.23
174 0.29
175 0.34
176 0.35
177 0.37
178 0.35
179 0.38
180 0.37
181 0.36
182 0.31
183 0.26
184 0.24
185 0.22
186 0.23
187 0.19
188 0.16
189 0.16
190 0.15
191 0.14
192 0.14
193 0.16
194 0.14
195 0.12
196 0.16
197 0.23
198 0.33
199 0.39
200 0.48
201 0.53
202 0.56
203 0.6
204 0.62
205 0.63
206 0.55
207 0.55
208 0.56
209 0.56
210 0.59
211 0.55
212 0.5
213 0.49
214 0.55
215 0.54
216 0.52
217 0.55
218 0.59
219 0.67
220 0.75
221 0.79
222 0.81
223 0.85
224 0.88
225 0.89
226 0.9
227 0.91
228 0.9
229 0.86
230 0.83
231 0.75
232 0.67
233 0.67
234 0.59
235 0.5