Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5B0R277

Protein Details
Accession A0A5B0R277    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
55-85LYPLNKPNNPKPKPKPKPKPKPQPKPSIILSHydrophilic
NLS Segment(s)
PositionSequence
57-79PLNKPNNPKPKPKPKPKPKPQPK
Subcellular Location(s) extr 18, mito 5, plas 2
Family & Domain DBs
Amino Acid Sequences MRLLLIVAALIPFAYLQEPGRQVQRDGTGFVDRLGENAVGDPIAIGIAPAKRKTLYPLNKPNNPKPKPKPKPKPKPQPKPSIILSDQGGGYIQHLRGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.06
3 0.07
4 0.12
5 0.15
6 0.16
7 0.23
8 0.24
9 0.24
10 0.26
11 0.31
12 0.27
13 0.27
14 0.27
15 0.24
16 0.23
17 0.22
18 0.21
19 0.15
20 0.14
21 0.14
22 0.11
23 0.09
24 0.09
25 0.08
26 0.06
27 0.06
28 0.05
29 0.03
30 0.03
31 0.03
32 0.02
33 0.04
34 0.06
35 0.08
36 0.08
37 0.09
38 0.1
39 0.11
40 0.16
41 0.24
42 0.31
43 0.39
44 0.49
45 0.56
46 0.63
47 0.69
48 0.74
49 0.75
50 0.71
51 0.72
52 0.72
53 0.76
54 0.79
55 0.84
56 0.86
57 0.87
58 0.94
59 0.94
60 0.96
61 0.95
62 0.96
63 0.94
64 0.94
65 0.87
66 0.82
67 0.75
68 0.73
69 0.63
70 0.56
71 0.47
72 0.39
73 0.34
74 0.27
75 0.24
76 0.15
77 0.15
78 0.16