Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1V1I0

Protein Details
Accession H1V1I0    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
3-27RSTSTSSRRRFTRKITKAKTCGRTWHydrophilic
NLS Segment(s)
PositionSequence
86-97RVSAKKKKHASS
Subcellular Location(s) mito 13.5, mito_nucl 11.833, nucl 9, cyto_nucl 6.833
Family & Domain DBs
Amino Acid Sequences MIRSTSTSSRRRFTRKITKAKTCGRTWSPPRSVVSPPARPPSTSKSTNPRCNTTSITNSTPHSGSCTICKLHPIFASFPMFSSSKRVSAKKKKHASSPGSWRRASGGWLTALSAFFVKGVFFFYRKRERGLDVTHPSHVLTVQGYMSVWRRQAKKECFVRLDGPINSTPLDFFSLPWSSLDEPMNTTTV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.78
3 0.83
4 0.85
5 0.86
6 0.87
7 0.89
8 0.86
9 0.79
10 0.78
11 0.73
12 0.74
13 0.71
14 0.72
15 0.67
16 0.65
17 0.64
18 0.59
19 0.56
20 0.55
21 0.55
22 0.52
23 0.53
24 0.56
25 0.54
26 0.51
27 0.53
28 0.51
29 0.5
30 0.48
31 0.48
32 0.5
33 0.59
34 0.67
35 0.67
36 0.65
37 0.59
38 0.58
39 0.56
40 0.51
41 0.48
42 0.43
43 0.41
44 0.37
45 0.36
46 0.35
47 0.31
48 0.25
49 0.23
50 0.2
51 0.18
52 0.18
53 0.2
54 0.19
55 0.19
56 0.23
57 0.2
58 0.22
59 0.23
60 0.23
61 0.21
62 0.24
63 0.26
64 0.22
65 0.21
66 0.2
67 0.18
68 0.16
69 0.2
70 0.18
71 0.21
72 0.25
73 0.29
74 0.37
75 0.47
76 0.57
77 0.61
78 0.69
79 0.67
80 0.7
81 0.75
82 0.7
83 0.67
84 0.69
85 0.68
86 0.64
87 0.61
88 0.53
89 0.46
90 0.41
91 0.35
92 0.25
93 0.18
94 0.13
95 0.13
96 0.13
97 0.12
98 0.11
99 0.1
100 0.08
101 0.06
102 0.05
103 0.05
104 0.05
105 0.04
106 0.07
107 0.08
108 0.1
109 0.13
110 0.2
111 0.3
112 0.31
113 0.35
114 0.35
115 0.38
116 0.42
117 0.45
118 0.47
119 0.44
120 0.45
121 0.43
122 0.4
123 0.36
124 0.3
125 0.25
126 0.17
127 0.1
128 0.09
129 0.08
130 0.08
131 0.08
132 0.1
133 0.14
134 0.16
135 0.2
136 0.25
137 0.29
138 0.36
139 0.47
140 0.52
141 0.58
142 0.63
143 0.67
144 0.64
145 0.65
146 0.61
147 0.57
148 0.56
149 0.47
150 0.43
151 0.36
152 0.34
153 0.31
154 0.27
155 0.21
156 0.16
157 0.19
158 0.15
159 0.14
160 0.18
161 0.19
162 0.2
163 0.2
164 0.23
165 0.2
166 0.24
167 0.26
168 0.22
169 0.23