Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B0NBT8

Protein Details
Accession A0A5B0NBT8   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
128-158AQSNPATRRRKPSDYPRRKKRPGPDFPDHLGBasic
NLS Segment(s)
PositionSequence
135-150RRRKPSDYPRRKKRPG
Subcellular Location(s) cyto_nucl 14.5, nucl 25
Family & Domain DBs
Amino Acid Sequences MSESSSEHSSTSSILSDSPQPSSIRDHSDQGQTSPVSEISELSCKEVQALKEYSHSVQNFTYQLFEKFRLELEAKGRSSKSVTENDHPSNPSMKPNSHSKTTANVGFHSTDLMIENSPLSPSFNPANAQSNPATRRRKPSDYPRRKKRPGPDFPDHLGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.18
4 0.19
5 0.21
6 0.23
7 0.22
8 0.24
9 0.3
10 0.31
11 0.32
12 0.33
13 0.34
14 0.35
15 0.41
16 0.4
17 0.35
18 0.35
19 0.28
20 0.27
21 0.24
22 0.21
23 0.15
24 0.14
25 0.13
26 0.11
27 0.16
28 0.15
29 0.18
30 0.18
31 0.17
32 0.19
33 0.22
34 0.2
35 0.21
36 0.22
37 0.2
38 0.21
39 0.23
40 0.22
41 0.25
42 0.25
43 0.21
44 0.2
45 0.22
46 0.2
47 0.18
48 0.19
49 0.14
50 0.17
51 0.17
52 0.19
53 0.17
54 0.16
55 0.16
56 0.17
57 0.17
58 0.17
59 0.18
60 0.22
61 0.22
62 0.24
63 0.23
64 0.21
65 0.21
66 0.21
67 0.22
68 0.23
69 0.26
70 0.28
71 0.34
72 0.35
73 0.36
74 0.34
75 0.31
76 0.28
77 0.25
78 0.26
79 0.24
80 0.23
81 0.23
82 0.32
83 0.34
84 0.35
85 0.36
86 0.32
87 0.34
88 0.37
89 0.38
90 0.3
91 0.27
92 0.26
93 0.24
94 0.23
95 0.18
96 0.14
97 0.1
98 0.1
99 0.1
100 0.08
101 0.08
102 0.08
103 0.07
104 0.08
105 0.08
106 0.09
107 0.08
108 0.12
109 0.14
110 0.16
111 0.17
112 0.19
113 0.26
114 0.24
115 0.27
116 0.26
117 0.31
118 0.33
119 0.41
120 0.47
121 0.46
122 0.56
123 0.6
124 0.67
125 0.69
126 0.76
127 0.79
128 0.82
129 0.87
130 0.88
131 0.91
132 0.92
133 0.91
134 0.91
135 0.9
136 0.9
137 0.88
138 0.86
139 0.82