Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5B0NGE1

Protein Details
Accession A0A5B0NGE1    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-36MGKNKRHNNASRKAAKKRCKAKKKQETREQLLKRTLHydrophilic
NLS Segment(s)
PositionSequence
4-25NKRHNNASRKAAKKRCKAKKKQ
Subcellular Location(s) nucl 17.5, mito_nucl 13, mito 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046798  2OG-FeII_Oxy_6  
Pfam View protein in Pfam  
PF20515  2OG-FeII_Oxy_6  
Amino Acid Sequences MGKNKRHNNASRKAAKKRCKAKKKQETREQLLKRTLNPSDTTHFVNWRRVKYEELDLYPTIPVDRHKKPTRPPTPEEIKSAYDQVETFHLFKTGRNIVQDPLDKESVIAFIDFIKFEDMSEQDKADLNLFTTFLHRSKKFISPVAVDSRSWGGLMWVIGWRKSSDGDQIISLDIISNKWLIPHLKKTKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.86
3 0.87
4 0.88
5 0.89
6 0.9
7 0.92
8 0.92
9 0.93
10 0.95
11 0.95
12 0.95
13 0.94
14 0.92
15 0.91
16 0.86
17 0.82
18 0.8
19 0.72
20 0.65
21 0.61
22 0.55
23 0.48
24 0.45
25 0.41
26 0.37
27 0.36
28 0.36
29 0.32
30 0.36
31 0.36
32 0.43
33 0.44
34 0.44
35 0.45
36 0.43
37 0.43
38 0.39
39 0.44
40 0.39
41 0.36
42 0.36
43 0.32
44 0.31
45 0.28
46 0.25
47 0.17
48 0.13
49 0.15
50 0.18
51 0.24
52 0.33
53 0.4
54 0.46
55 0.55
56 0.65
57 0.71
58 0.71
59 0.7
60 0.69
61 0.71
62 0.67
63 0.62
64 0.54
65 0.46
66 0.39
67 0.36
68 0.28
69 0.2
70 0.17
71 0.13
72 0.13
73 0.12
74 0.12
75 0.11
76 0.12
77 0.12
78 0.12
79 0.17
80 0.18
81 0.18
82 0.19
83 0.2
84 0.19
85 0.23
86 0.26
87 0.22
88 0.22
89 0.21
90 0.18
91 0.17
92 0.17
93 0.13
94 0.1
95 0.08
96 0.05
97 0.05
98 0.06
99 0.06
100 0.06
101 0.07
102 0.07
103 0.07
104 0.08
105 0.09
106 0.12
107 0.13
108 0.12
109 0.12
110 0.13
111 0.14
112 0.13
113 0.12
114 0.1
115 0.1
116 0.1
117 0.1
118 0.11
119 0.13
120 0.15
121 0.22
122 0.21
123 0.24
124 0.28
125 0.34
126 0.36
127 0.38
128 0.39
129 0.35
130 0.39
131 0.44
132 0.42
133 0.34
134 0.33
135 0.3
136 0.26
137 0.23
138 0.18
139 0.11
140 0.1
141 0.11
142 0.1
143 0.12
144 0.13
145 0.14
146 0.16
147 0.16
148 0.16
149 0.18
150 0.19
151 0.21
152 0.23
153 0.24
154 0.23
155 0.24
156 0.23
157 0.21
158 0.19
159 0.14
160 0.11
161 0.1
162 0.1
163 0.1
164 0.09
165 0.11
166 0.15
167 0.2
168 0.27
169 0.37