Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B0SJI2

Protein Details
Accession A0A5B0SJI2    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MLKNKKRKEGCKKRWRQKTRKASGNEASTHydrophilic
45-65VSLYDEYRQRRKKKYLTPASIHydrophilic
NLS Segment(s)
PositionSequence
3-22KNKKRKEGCKKRWRQKTRKA
Subcellular Location(s) nucl 12mito_nucl 12, mito 10, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046798  2OG-FeII_Oxy_6  
Pfam View protein in Pfam  
PF20515  2OG-FeII_Oxy_6  
Amino Acid Sequences MLKNKKRKEGCKKRWRQKTRKASGNEASTEIKKGLYQFTARPSPVSLYDEYRQRRKKKYLTPASILQAANFIKAPGFRIFNRPDSHVMIFDEYNQNRLVGIFQFTPFSKMTPDQREDLDFLAGFFHSHKKYVNPVSNFNSACLGGKMNMLGWRKCMKPNERAGLFLSQAKINKDVHGFTSVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.96
2 0.96
3 0.95
4 0.95
5 0.95
6 0.94
7 0.92
8 0.87
9 0.85
10 0.82
11 0.77
12 0.68
13 0.6
14 0.54
15 0.46
16 0.41
17 0.33
18 0.25
19 0.2
20 0.2
21 0.2
22 0.19
23 0.21
24 0.22
25 0.29
26 0.34
27 0.33
28 0.32
29 0.3
30 0.29
31 0.29
32 0.29
33 0.24
34 0.23
35 0.27
36 0.34
37 0.38
38 0.45
39 0.51
40 0.56
41 0.63
42 0.67
43 0.73
44 0.75
45 0.81
46 0.82
47 0.8
48 0.77
49 0.72
50 0.65
51 0.61
52 0.51
53 0.4
54 0.33
55 0.26
56 0.22
57 0.17
58 0.15
59 0.1
60 0.1
61 0.13
62 0.11
63 0.14
64 0.14
65 0.21
66 0.24
67 0.29
68 0.31
69 0.3
70 0.31
71 0.31
72 0.31
73 0.25
74 0.23
75 0.19
76 0.17
77 0.16
78 0.2
79 0.16
80 0.17
81 0.16
82 0.15
83 0.13
84 0.14
85 0.13
86 0.07
87 0.09
88 0.08
89 0.08
90 0.1
91 0.1
92 0.13
93 0.13
94 0.12
95 0.13
96 0.15
97 0.22
98 0.27
99 0.29
100 0.28
101 0.29
102 0.31
103 0.3
104 0.27
105 0.21
106 0.14
107 0.12
108 0.11
109 0.09
110 0.08
111 0.08
112 0.13
113 0.13
114 0.14
115 0.16
116 0.18
117 0.26
118 0.34
119 0.41
120 0.39
121 0.45
122 0.49
123 0.55
124 0.52
125 0.45
126 0.38
127 0.3
128 0.28
129 0.22
130 0.18
131 0.12
132 0.12
133 0.12
134 0.12
135 0.18
136 0.21
137 0.21
138 0.25
139 0.29
140 0.31
141 0.38
142 0.45
143 0.46
144 0.5
145 0.59
146 0.64
147 0.6
148 0.6
149 0.56
150 0.51
151 0.46
152 0.41
153 0.33
154 0.28
155 0.3
156 0.3
157 0.32
158 0.29
159 0.31
160 0.31
161 0.31
162 0.29