Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1VF97

Protein Details
Accession H1VF97   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
280-309MDVRKFRPTSSSRARPRRSRRTSGASSHSRHydrophilic
NLS Segment(s)
PositionSequence
291-300SRARPRRSRR
Subcellular Location(s) nucl 15.5, cyto_nucl 10.333, cyto_mito 4.833, mito 4.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR005303  MOCOS_middle  
Pfam View protein in Pfam  
PF03476  MOSC_N  
Amino Acid Sequences MLLLSWWSQQSPLCSSVYDFSDHRPPGTHWRSHRYDRLSPPFSFLAKQQDQTETIVVIRRKQLYVYPVKGLRGCELQEARVGQHGFVGDRTFSLQKVHRDENDPSEKTYETLLIGRCLQLALFETSVHNVSNEVAVKWHDRETEFDKRAADAKVDTDDEIRFPLSPGLEGLEECEVSLHVSRTKAYDMGDGPASWFSDRLGFETRLVYIGDGSRAVLGSLAPNSRGGLKKAKWTSRLRALVPSLAFREERLVFNDLGHYLVVTEASNSQVSSRLEGGAEMDVRKFRPTSSSRARPRRSRRTSGASSHSRAASGCH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.24
3 0.26
4 0.26
5 0.25
6 0.22
7 0.24
8 0.32
9 0.32
10 0.32
11 0.31
12 0.33
13 0.4
14 0.47
15 0.5
16 0.48
17 0.57
18 0.63
19 0.68
20 0.73
21 0.7
22 0.71
23 0.73
24 0.76
25 0.73
26 0.65
27 0.62
28 0.57
29 0.51
30 0.43
31 0.36
32 0.36
33 0.35
34 0.37
35 0.35
36 0.35
37 0.35
38 0.36
39 0.33
40 0.24
41 0.21
42 0.24
43 0.23
44 0.23
45 0.27
46 0.28
47 0.28
48 0.29
49 0.31
50 0.34
51 0.41
52 0.41
53 0.42
54 0.41
55 0.44
56 0.45
57 0.42
58 0.37
59 0.31
60 0.29
61 0.29
62 0.28
63 0.26
64 0.27
65 0.26
66 0.24
67 0.26
68 0.25
69 0.17
70 0.18
71 0.18
72 0.15
73 0.15
74 0.15
75 0.1
76 0.1
77 0.13
78 0.12
79 0.12
80 0.16
81 0.2
82 0.26
83 0.32
84 0.36
85 0.36
86 0.41
87 0.43
88 0.47
89 0.51
90 0.45
91 0.4
92 0.37
93 0.34
94 0.3
95 0.28
96 0.2
97 0.12
98 0.15
99 0.14
100 0.14
101 0.14
102 0.14
103 0.13
104 0.12
105 0.1
106 0.08
107 0.09
108 0.09
109 0.08
110 0.08
111 0.09
112 0.1
113 0.11
114 0.1
115 0.08
116 0.07
117 0.07
118 0.09
119 0.09
120 0.08
121 0.08
122 0.1
123 0.12
124 0.13
125 0.14
126 0.14
127 0.14
128 0.17
129 0.23
130 0.31
131 0.31
132 0.31
133 0.3
134 0.29
135 0.31
136 0.28
137 0.22
138 0.13
139 0.12
140 0.13
141 0.13
142 0.12
143 0.11
144 0.1
145 0.1
146 0.1
147 0.09
148 0.07
149 0.07
150 0.08
151 0.07
152 0.07
153 0.07
154 0.07
155 0.07
156 0.07
157 0.07
158 0.06
159 0.06
160 0.06
161 0.06
162 0.05
163 0.05
164 0.07
165 0.07
166 0.08
167 0.09
168 0.1
169 0.11
170 0.12
171 0.13
172 0.12
173 0.15
174 0.14
175 0.15
176 0.15
177 0.14
178 0.13
179 0.13
180 0.12
181 0.09
182 0.09
183 0.07
184 0.11
185 0.11
186 0.13
187 0.17
188 0.17
189 0.18
190 0.19
191 0.18
192 0.15
193 0.15
194 0.12
195 0.09
196 0.09
197 0.09
198 0.08
199 0.08
200 0.07
201 0.07
202 0.07
203 0.06
204 0.05
205 0.06
206 0.08
207 0.09
208 0.09
209 0.1
210 0.1
211 0.15
212 0.17
213 0.19
214 0.25
215 0.27
216 0.36
217 0.44
218 0.5
219 0.54
220 0.59
221 0.64
222 0.65
223 0.69
224 0.61
225 0.59
226 0.54
227 0.51
228 0.45
229 0.4
230 0.31
231 0.28
232 0.26
233 0.21
234 0.24
235 0.21
236 0.22
237 0.22
238 0.23
239 0.21
240 0.21
241 0.23
242 0.18
243 0.17
244 0.15
245 0.11
246 0.08
247 0.08
248 0.08
249 0.06
250 0.07
251 0.06
252 0.09
253 0.09
254 0.09
255 0.1
256 0.15
257 0.16
258 0.18
259 0.18
260 0.17
261 0.17
262 0.17
263 0.18
264 0.15
265 0.16
266 0.14
267 0.15
268 0.17
269 0.18
270 0.21
271 0.2
272 0.18
273 0.26
274 0.29
275 0.36
276 0.45
277 0.54
278 0.62
279 0.72
280 0.81
281 0.82
282 0.89
283 0.91
284 0.9
285 0.89
286 0.87
287 0.86
288 0.85
289 0.82
290 0.81
291 0.78
292 0.73
293 0.69
294 0.61
295 0.52