Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B0PK05

Protein Details
Accession A0A5B0PK05   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
81-100EMRCCRKKAFDLPQNPKHKFHydrophilic
NLS Segment(s)
Subcellular Location(s) E.R. 12, extr 8, golg 3, pero 2
Family & Domain DBs
Amino Acid Sequences MQLLKSLILMAIVTFQIVIADQQDHPKTFVCRRNAYESEDERIAVCGGVSKTDPKKYEMTRANTVVDDEFAHNCIGAPLQEMRCCRKKAFDLPQNPKHKFKTITVDFSATEKNDNCVGVKLEGAFGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.05
4 0.05
5 0.06
6 0.06
7 0.08
8 0.09
9 0.16
10 0.19
11 0.2
12 0.21
13 0.24
14 0.28
15 0.34
16 0.41
17 0.41
18 0.45
19 0.48
20 0.55
21 0.55
22 0.55
23 0.54
24 0.5
25 0.47
26 0.41
27 0.36
28 0.28
29 0.26
30 0.21
31 0.13
32 0.1
33 0.09
34 0.09
35 0.09
36 0.1
37 0.15
38 0.18
39 0.24
40 0.25
41 0.25
42 0.31
43 0.31
44 0.4
45 0.42
46 0.44
47 0.43
48 0.44
49 0.42
50 0.36
51 0.34
52 0.25
53 0.18
54 0.13
55 0.1
56 0.09
57 0.09
58 0.08
59 0.08
60 0.07
61 0.07
62 0.06
63 0.05
64 0.06
65 0.09
66 0.11
67 0.14
68 0.17
69 0.23
70 0.29
71 0.32
72 0.32
73 0.34
74 0.39
75 0.46
76 0.55
77 0.58
78 0.61
79 0.69
80 0.77
81 0.81
82 0.78
83 0.75
84 0.69
85 0.68
86 0.61
87 0.57
88 0.58
89 0.55
90 0.57
91 0.53
92 0.51
93 0.44
94 0.42
95 0.41
96 0.31
97 0.3
98 0.23
99 0.24
100 0.24
101 0.24
102 0.23
103 0.22
104 0.24
105 0.2
106 0.2
107 0.18