Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5B0NLQ4

Protein Details
Accession A0A5B0NLQ4    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
11-53LTNLNPNPKPQPKPKPKLKPNPKPNPKPKPKPKPNPPLKQGPLHydrophilic
NLS Segment(s)
PositionSequence
18-47PKPQPKPKPKLKPNPKPNPKPKPKPKPNPP
Subcellular Location(s) nucl 13, mito 12
Family & Domain DBs
Amino Acid Sequences MEFLLDKSIPLTNLNPNPKPQPKPKPKLKPNPKPNPKPKPKPKPNPPLKQGPLDFQQLRQVPNGPTIPRQMNYST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.4
3 0.42
4 0.5
5 0.56
6 0.6
7 0.62
8 0.65
9 0.68
10 0.76
11 0.82
12 0.84
13 0.87
14 0.91
15 0.92
16 0.92
17 0.92
18 0.93
19 0.93
20 0.92
21 0.93
22 0.92
23 0.92
24 0.92
25 0.92
26 0.92
27 0.92
28 0.92
29 0.92
30 0.92
31 0.92
32 0.91
33 0.86
34 0.85
35 0.77
36 0.74
37 0.65
38 0.58
39 0.51
40 0.5
41 0.45
42 0.36
43 0.4
44 0.35
45 0.35
46 0.33
47 0.33
48 0.27
49 0.32
50 0.36
51 0.3
52 0.31
53 0.36
54 0.4
55 0.37