Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B0MQU0

Protein Details
Accession A0A5B0MQU0    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-43MPSKAENAQRQRQRNKKNTSDESNKNKKKKPNGPNKVKTQAKSHydrophilic
NLS Segment(s)
PositionSequence
14-53RNKKNTSDESNKNKKKKPNGPNKVKTQAKSDKDKGKNSRR
Subcellular Location(s) nucl 24.5, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MPSKAENAQRQRQRNKKNTSDESNKNKKKKPNGPNKVKTQAKSDKDKGKNSRRSQDHSNNPIEVNSDGDKHENPIVIGSDGKES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.86
3 0.86
4 0.87
5 0.85
6 0.84
7 0.83
8 0.82
9 0.82
10 0.84
11 0.83
12 0.81
13 0.79
14 0.78
15 0.8
16 0.8
17 0.8
18 0.81
19 0.83
20 0.86
21 0.87
22 0.87
23 0.86
24 0.8
25 0.71
26 0.69
27 0.67
28 0.61
29 0.61
30 0.59
31 0.59
32 0.61
33 0.68
34 0.69
35 0.7
36 0.75
37 0.74
38 0.77
39 0.73
40 0.72
41 0.73
42 0.74
43 0.73
44 0.7
45 0.67
46 0.59
47 0.54
48 0.48
49 0.4
50 0.3
51 0.24
52 0.18
53 0.16
54 0.15
55 0.18
56 0.18
57 0.19
58 0.21
59 0.19
60 0.17
61 0.18
62 0.19
63 0.17
64 0.18