Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1VSU9

Protein Details
Accession H1VSU9    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
82-108DDKATTAKAPAKRKRERYKNAPPSVLSHydrophilic
NLS Segment(s)
PositionSequence
89-99KAPAKRKREXR
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MDHSLPLNMYDDVDAFLDMDAPYIYDEPEQYLDTASSSESTSPIMSSFDTTFVNDFNGVDQSMYPSPMSSNRDTASPQPTSDDKATTAKAPAKRKREXRYKNAPPSVLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.08
3 0.07
4 0.08
5 0.07
6 0.08
7 0.06
8 0.06
9 0.07
10 0.07
11 0.08
12 0.07
13 0.07
14 0.09
15 0.1
16 0.11
17 0.1
18 0.1
19 0.1
20 0.09
21 0.09
22 0.08
23 0.07
24 0.07
25 0.07
26 0.07
27 0.07
28 0.07
29 0.07
30 0.07
31 0.07
32 0.07
33 0.09
34 0.09
35 0.09
36 0.1
37 0.1
38 0.1
39 0.09
40 0.09
41 0.07
42 0.07
43 0.06
44 0.06
45 0.06
46 0.06
47 0.05
48 0.08
49 0.08
50 0.09
51 0.09
52 0.08
53 0.09
54 0.14
55 0.19
56 0.17
57 0.2
58 0.2
59 0.21
60 0.23
61 0.27
62 0.27
63 0.24
64 0.23
65 0.24
66 0.24
67 0.28
68 0.28
69 0.25
70 0.22
71 0.24
72 0.25
73 0.23
74 0.27
75 0.29
76 0.35
77 0.43
78 0.5
79 0.57
80 0.66
81 0.75
82 0.81
83 0.86
84 0.89
85 0.89
86 0.92
87 0.92
88 0.91