Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5B0QVM9

Protein Details
Accession A0A5B0QVM9    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
3-29KFSKDVSSSRRKSRKAHFQAPSHERRIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito_nucl 13.333, mito 10.5, cyto_nucl 8.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR005824  KOW  
IPR041988  KOW_RPL26/RPL24  
IPR014722  Rib_L2_dom2  
IPR005825  Ribosomal_L24/26_CS  
IPR005756  Ribosomal_L26/L24P_euk/arc  
IPR008991  Translation_prot_SH3-like_sf  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00467  KOW  
PF16906  Ribosomal_L26  
PROSITE View protein in PROSITE  
PS01108  RIBOSOMAL_L24  
CDD cd06089  KOW_RPL26  
Amino Acid Sequences MAKFSKDVSSSRRKSRKAHFQAPSHERRIIMSSGLSKELRAKYNVRSMPIRKDDEVVVVRGAFKGREGKVLSVYRKKYVIHVDKVTRDKASGQTVQIGVHPSKVVISKLYLDKDRKAILARKDRGSPKEKMQVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.78
3 0.81
4 0.8
5 0.83
6 0.81
7 0.78
8 0.82
9 0.83
10 0.8
11 0.73
12 0.66
13 0.56
14 0.49
15 0.45
16 0.36
17 0.28
18 0.23
19 0.22
20 0.21
21 0.25
22 0.23
23 0.19
24 0.25
25 0.28
26 0.29
27 0.28
28 0.3
29 0.31
30 0.4
31 0.41
32 0.38
33 0.41
34 0.41
35 0.46
36 0.5
37 0.49
38 0.4
39 0.4
40 0.36
41 0.35
42 0.32
43 0.24
44 0.18
45 0.15
46 0.14
47 0.13
48 0.13
49 0.08
50 0.08
51 0.13
52 0.13
53 0.18
54 0.18
55 0.19
56 0.24
57 0.29
58 0.33
59 0.34
60 0.36
61 0.33
62 0.34
63 0.34
64 0.33
65 0.38
66 0.4
67 0.39
68 0.43
69 0.45
70 0.49
71 0.53
72 0.5
73 0.41
74 0.34
75 0.31
76 0.29
77 0.3
78 0.26
79 0.23
80 0.25
81 0.25
82 0.25
83 0.24
84 0.23
85 0.18
86 0.16
87 0.16
88 0.12
89 0.13
90 0.15
91 0.14
92 0.12
93 0.14
94 0.17
95 0.22
96 0.27
97 0.32
98 0.34
99 0.37
100 0.4
101 0.4
102 0.38
103 0.4
104 0.42
105 0.45
106 0.52
107 0.55
108 0.55
109 0.62
110 0.67
111 0.69
112 0.68
113 0.64
114 0.62